KEGG   Rattus norvegicus (rat): 83589
Entry
83589             CDS       T01003                                 

Gene name
Apba1, Mint1
Definition
(RefSeq) amyloid beta precursor protein binding family A member 1
  KO
K04531  amyloid beta A4 precursor protein-binding family A member 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    83589 (Apba1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    83589 (Apba1)
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    83589 (Apba1)
SSDB
Motif
Pfam: PID PDZ PDZ_6 PDZ_2 NRho PRT6_C CATSPERG
Other DBs
NCBI-GeneID: 83589
NCBI-ProteinID: NP_113967
RGD: 620844
Ensembl: ENSRNOG00000014928
UniProt: O35430
Structure
PDB: 
4DBB

Position
1q51
AA seq 839 aa
MNHLEGSAEVEVADEAPGGEVNESVEADLEHPEVEEEQQPSPPPPAGHAPEDHRAHPAPP
PPPPPQEEEEERGECLARSASTESGFHNHTDTAEGDVLAAARDGYEAERAQDADDESAYA
VQYRPEAEEYTEQAEAEHAEAAQRRALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRAE
DEPYAEPYADYGGLQEHVYEEIGDAPELEARDGLRLYERERDEAAAYRQEALGARLHHYD
ERSDGESDSPEKEAEFAPYPRMDSYEQEEDIDQIVAEVKQSMSSQSLDKAAEDMPEAEQD
LERAPTPGGGHPDSPGLPAPAGQQQRVVGTPGGSEVGQRYSKEKRDAISLAIKDIKEAIE
EVKTRTIRSPYTPDEPKEPIWVMRQDISPTRDCDDQRPVDGDSPSPGSSSPLGAESSITP
LHPGDPTEASTNKESRKSLASFPTYVEVPGPCDPEDLIDGIIFAANYLGSTQLLSDKTPS
KNVRMMQAQEAVSRIKTAQKLAKSRKKAPEGESQPMTEVDLFISTQRIKVLNADTQEPMM
DHPLRTISYIADIGNIVVLMARRRMPRSNSQENVEASHPSQDAKRQYKMICHVFESEDAQ
LIAQSIGQAFSVAYQEFLRANGINPEDLSQKEYSDLLNTQDMYNDDLIHFSKSENCKDVF
IEKQKGEILGVVIVESGWGSILPTVIIANMMHGGPAEKSGKLNIGDQIMSINGTSLVGLP
LSTCQSIIKGLKNQSRVKLNIVRCPPVTTVLIRRPDLRYQLGFSVQNGIICSLMRGGIAE
RGGVRVGHRIIEINGQSVVATPHEKIVHILSNAVGEIHMKTMPAAMYRLLTAQEQPVYI
NT seq 2520 nt   +upstreamnt  +downstreamnt
atgaaccacttggagggctccgcggaggtggaggtggccgacgaggcgccaggaggggag
gtgaacgagtccgtggaggccgacctggagcaccccgaggtggaggaagagcagcagccg
tcgcccccgccgcccgcaggtcacgcacccgaggaccaccgcgcgcatccggcgccgccg
ccgccgccaccaccgcaggaggaggaggaggagcgcggcgagtgcctggctcgctcggcc
agcaccgagagcggcttccacaaccacacggacaccgctgagggcgacgtgctcgccgcg
gcccgagacggctacgaggcggagcgcgcgcaggacgccgacgatgagagcgcctacgcc
gtgcagtaccggcccgaggccgaggagtacacggagcaggcggaggccgagcacgccgag
gcggcgcagcggcgcgcgctgcccaaccacctgcacttccactcgctggagcacgaggaa
gccatgaacgccgcctactcgggctatgtctacacgcaccggctcttccaccgcgccgag
gacgagccctacgccgagccctacgccgactacggcggcctccaggagcacgtgtacgag
gagatcggggacgcgcctgagctggaggcgcgcgacggcctgcggctctatgagcgggag
cgcgacgaggcggccgcctaccgccaggaggccctaggcgcgcggctgcaccactacgac
gagcgctccgacggcgagtccgacagccccgagaaggaggcggagttcgcgccctacccg
cgcatggacagttatgagcaggaagaggacatcgaccagatcgtggccgaggtcaagcag
agcatgagctcgcagagcctcgacaaggcggccgaagacatgcccgaggcggagcaggac
ctggagcgcgccccgaccccgggagggggacaccccgacagccctgggctgccagcacct
gccgggcagcagcagcgagttgtgggaaccccgggaggcagcgaggttggtcagcggtac
agcaaggaaaagagggatgccatctcgctggccatcaaggacatcaaggaggccatcgaa
gaagtgaaaaccaggaccatccgttcgccttacacccccgacgaacccaaagagcccatc
tgggtcatgcgccaggacattagccccacaagggactgtgacgaccagaggcccgtggac
ggagattctccgtctcctggcagttcctcacccctgggtgctgagtcatcaatcacaccc
cttcatcccggtgaccccacggaagcctccactaataaagagtcaagaaaaagcttggct
tcattcccaacctacgttgaagttcctggaccctgcgaccctgaagacttgatcgatgga
attatttttgctgccaattaccttggttccactcagctactctcagacaaaactccctcc
aaaaacgtgcgcatgatgcaggcccaggaagcagtaagccggatcaagacggcccagaaa
ttagccaaaagcaggaagaaggctcctgaaggcgaatctcagccaatgactgaggtggac
ctcttcatctccacccagaggatcaaagtgttgaatgcagatacacaggagcctatgatg
gaccaccctctgaggaccatttcctacatcgcagacattgggaacatcgtcgtgctgatg
gcccgcaggcggatgccccgctccaactcccaggagaatgtggaggcctctcacccatcc
caggatgcaaaacggcagtacaagatgatctgtcatgtctttgagtctgaggacgcccag
ctgatcgcacagtccatcgggcaggccttcagcgttgcataccaggagttcctcagggcc
aacgggattaacccagaagacctgagccagaaggagtacagcgacctgctcaacacccag
gacatgtacaacgatgacctgatccacttctccaagtcggaaaactgcaaagatgtcttc
atagagaagcagaaaggagaaatcctgggagttgtgattgtggagtctggctggggatcc
attctgccaaccgtgatcattgccaacatgatgcacggaggccccgccgagaagtcgggg
aagctgaacatcggggaccagatcatgtccattaacggcaccagcctggtgggcctgccc
ctgtccacctgccagagcatcattaagggcttaaagaaccagtcccgcgtgaagctgaac
atcgtgaggtgccccccagtgaccacagtgctaattaggaggccggaccttcgctaccag
ctgggtttcagcgtgcagaatggaattatctgtagcctcatgagagggggaatagctgag
agaggaggtgtccgcgtgggacatcggatcattgaaatcaacggccagagtgtcgtagcc
acaccacacgagaagatcgtccacatactctccaatgctgttggggagatccacatgaag
acaatgccagcagccatgtacagactgctgacagcccaggagcagcccgtttacatctga

DBGET integrated database retrieval system