KEGG   Rattus norvegicus (rat): 83610Help
Entry
83610             CDS       T01003                                 

Gene name
Apba2, Mint2
Definition
(RefSeq) amyloid beta precursor protein binding family A member 2
  KO
K20055  amyloid beta A4 precursor protein-binding family A member 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    83610 (Apba2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    83610 (Apba2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PID PDZ PDZ_6 PDZ_2 NRho
Motif
Other DBs
NCBI-GeneID: 83610
NCBI-ProteinID: NP_113968
RGD: 620845
Ensembl: ENSRNOG00000016358
UniProt: O35431
Structure
PDB: 

Position
1q22
AA seq 750 aa AA seqDB search
MAHRKRQSTASSMLDHRARPGPIPHDQEPENEDTELPLESYVPTGLELGTLRPDSPTPEE
QECHNHSPDGDSSSDYVNNTSEEEDYDEGLPEEEEGVTYYIRYCPEDDSYLEGMDCNGEE
YLAHGAHPVDTDECQEAVEDWTDSVGPHTHSHGAENSQEYPDSHLPIPEDDPTVLEVHDQ
EEDGHYCPSKESYQDYYPPETNGNTGGASPYRMRRGDGDLEEQEEDIDQIVAEIKMSLSM
TSITSASEASPEHMPELDPGDSTEACSPSDTGRGPSRQEARPKSLNLPPEVKHSGDPQRG
LKTKTRTPEERPKWPQEQVCNGLEQPRKQQRSDLNGPTDNNNIPETKKVASFPSFVAVPG
PCEPEDLIDGIIFAANYLGSTQLLSERNPSKNIRMMQAQEAVSRVKRMQKAAKIKKKANS
EGDAQTLTEVDLFISTQRIKVLNADTQETMMDHALRTISYIADIGNIVVLMARRRMPRSA
SQDCIETTPGAQEGKKQYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLRANGINPEDLS
QKEYSDIINTQEMYNDDLIHFSNSENCKELQLEKHKGEILGVVVVESGWGSILPTVILAN
MMNGGPAARSGKLSIGDQIMSINGTSLVGLPLATCQGIIKGLKNQTQVKLNIVSCPPVTT
VLIKRPDLKYQLGFSVQNGIICSLMRGGIAERGGVRVGHRIIEINGQSVVATAHEKIVQA
LSNSVGEIHMKTMPAAMFRLLTGQETPLYI
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atggcccaccgcaagcgccagagcactgcaagcagcatgttggaccacagggcccggcca
ggtcctatcccccatgaccaggagcctgagaatgaggatacagaactgcctctggagagc
tatgtacccacaggcctggagctaggcactctgagaccagacagccccacgcctgaggaa
caggagtgccacaaccatagccctgatggggactccagctctgactatgtgaacaacacg
tctgaggaggaggactatgacgagggcctccctgaggaggaggaaggtgtcacctactac
atccgctattgtcctgaggatgacagctacctggagggcatggactgtaatggggaggag
tacctagcccatggtgcacatcctgtggacactgatgagtgtcaggaggcggtagaggac
tggacggactcagtgggtcctcatactcatagccacggggctgaaaacagccaagagtat
ccagacagccacctgcctatcccagaggatgaccctactgtcctggaggtccatgaccag
gaagaagatggccactactgtcccagcaaggagagctaccaggactattatcccccagag
accaatgggaacacgggtggcgcttctccctatcgcatgaggcgtggggatggggaccta
gaggagcaggaggaagacatcgaccagatagtggctgagatcaagatgagcctgagcatg
accagtattaccagtgccagtgaggccagccctgagcacatgcctgagctggaccctggg
gactccactgaggcctgttcacccagtgacactggccgtggacccagtaggcaagaagcg
aggcccaagtcgctgaaccttccccctgaggttaagcactccggagacccccaaagagga
ctcaagaccaagaccaggaccccagaggagaggccaaagtggccccaagagcaggtttgc
aatggcttggaacagccgaggaagcagcagcgctctgatctcaatggacccactgacaat
aacaacatcccagagacaaagaaggtggcctcgtttccaagctttgtagctgttccaggg
ccctgtgagccagaagacctcatcgatggcatcatctttgcagccaactacctgggctcc
acccagctgctctctgagcgcaacccctccaaaaacatccgaatgatgcaagctcaagaa
gctgtcagcagggtcaagaggatgcagaaggctgctaagatcaagaaaaaagcgaattct
gagggtgatgctcagacactgacagaagtagacctcttcatttctacccagaggatcaaa
gtcttaaacgctgacacacaggaaaccatgatggaccatgccttgcgcaccatctcctac
attgcagacattgggaacatcgtggttctgatggccaggcgccgcatgcccaggtcagcc
tctcaggactgcatcgagaccacgcctggggcccaggaagggaagaagcagtacaagatg
atctgtcacgtgttcgagtcagaggatgcccagctgatagcccagtcaattgggcaggcc
ttcagtgtggcctaccaggagttcctgagggccaacggcatcaaccctgaggacctgagc
cagaaggaatacagtgatatcataaatacccaggagatgtataatgatgaccttatccac
ttctcaaactcggagaactgcaaggagctgcagctggagaagcacaagggtgagattttg
ggtgtggtggtcgtggagtcaggctggggctccatcctgcccactgtgatcctggcgaac
atgatgaacggcggcccagcagctcgctcggggaagctgagcattggcgaccagatcatg
tccatcaatggcaccagcctggtggggctgcccctcgctacctgccagggtatcatcaag
ggcctgaagaaccaaacacaggtaaagctcaacatcgtcagctgtcccccagtcaccaca
gtcctcatcaaacgtccagatctcaagtaccagctgggtttcagcgtgcaaaatggaatc
atttgcagcctcatgagagggggtattgcagagcgaggtggtgtccgagtcggccaccgt
atcatcgagatcaacggacagagtgtggtagccacagcccacgagaagatagtccaggct
ctgtctaactcagttggagagattcacatgaagaccatgcctgcagccatgttcaggctc
ctcacaggccaggagacaccgctgtacatctag

DBGET integrated database retrieval system