KEGG   Rattus norvegicus (rat): 83613
Entry
83613             CDS       T01003                                 

Gene name
Nefl
Definition
(RefSeq) neurofilament light polypeptide
  KO
K04572  neurofilament light polypeptide
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    83613 (Nefl)
   05022 Pathways of neurodegeneration - multiple diseases
    83613 (Nefl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    83613 (Nefl)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    83613 (Nefl)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     83613 (Nefl)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type IV
     83613 (Nefl)
SSDB
Motif
Pfam: Filament Filament_head TPR_MLP1_2 DUF1664
Other DBs
NCBI-GeneID: 83613
NCBI-ProteinID: NP_113971
RGD: 621458
Ensembl: ENSRNOG00000013658
UniProt: P19527
Position
15
AA seq 542 aa
MSSFSYEPYFSTSYKRRYVETPRVHISSVRSGYSTARSAYSSYSAPVSSSLSVRRSYSSS
SGSLMPSLENLDLSQVAAISNDLKSIRTQEKAQLQDLNDRFASFIERVHELEQQNKVLEA
ELLVLRQKHSEPSRFRALYEQEIRDLRLAAEDATNEKQALQGEREGLEETLRNLQARYEE
EVLSREDAEGRLMEARKGADEAALARAELEKRIDSLMDEIAFLKKVHEEEIAELQAQIQY
AQISVEMDVSSKPDLSAALKDIRAQYEKLAAKNMQNAEEWFKSRFTVLTESAAKNTDAVR
AAKDEVSESRRLLKAKTLEIEACRGMNEALEKQLQELEDKQNADISAMQDTINKLENELR
STKSEMARYLKEYQDLLNVKMALDIEIAAYRKLLEGEETRLSFTSVGSITSGYSQSSQVF
GRSAYSGLQSSSYLMSARAFPAYYTSHVQEEQSEVEETIEATKAEEAKDEPPSEGEAEEE
EKEKEEGEEEEGAEEEEAAKDESEDAKEEEGGEGEEEDTKESEEEEKKEESAGEEQAAKK
KD
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgagttcgttcagctacgagccgtacttttcgacctcctacaagcggcgctacgtggag
acgccccgggtgcacatctccagcgtgcgcagcggctacagcacggcgcgctctgcgtac
tccagctactccgcgcccgtctcctcctctctgtcggtgcgccgcagctactcatccagc
tccggctctttgatgcccagcctggagaacctcgatctgagccaggtagccgccatcagc
aacgacctcaagtctatccgcacacaggagaaggcacagctgcaggacctcaacgatcgc
ttcgccagcttcatcgagcgcgtgcacgagctggagcagcagaacaaggtcctggaagcc
gagctgttggtgctgcgccagaagcactcagagccttcccgcttccgcgccctgtatgag
caggagatccgtgatctgcgactggcggccgaagacgccactaacgagaagcaggcgctg
cagggcgagcgcgaggggctggaggagactctgcgcaacctgcaggctcgctacgaggag
gaggtgctgagccgcgaggacgccgagggccggctgatggaagcccgcaaaggcgcggat
gaggctgcgctcgcccgcgccgagctggagaagcgcatcgacagcctgatggacgagata
gccttcctgaaaaaggtgcacgaggaagagatcgccgagctgcaggctcagatccagtat
gctcagatctccgtggagatggacgtgtcctccaagcccgacctctccgccgctctcaag
gacatccgcgctcagtacgagaagctggccgccaagaatatgcagaatgccgaagagtgg
ttcaagagccgcttcacggtgctaaccgagagcgccgccaagaacaccgacgcagtgcgc
gctgccaaggacgaggtgtcggaaagccgccgcctacttaaggctaagaccctggagatc
gaagcctgccggggtatgaacgaagctctagagaagcagctgcaggagctggaggacaag
cagaatgcagacatcagcgccatgcaggacacaatcaacaaactggagaatgagctgcga
agcacgaagagcgagatggccaggtacctgaaggagtaccaggacctcctcaatgtcaag
atggcattggacattgagattgcagcttacaggaaactcttggaaggcgaagaaaccagg
ctcagtttcaccagcgtgggtagcataaccagcggctactctcagagctcgcaggtcttt
ggccgttctgcttacagtggcttgcagagcagctcctacttgatgtctgctcgagcattc
ccagcctactataccagccacgtccaggaagagcagtcagaggtggaggagaccattgag
gctacgaaagctgaggaggccaaggatgagcccccctctgaaggagaagcagaagaggag
gagaaggagaaagaggagggggaggaagaggaaggtgctgaggaggaagaagctgccaag
gatgagtctgaagatgccaaagaagaagaaggtggtgagggtgaagaggaagacaccaaa
gagtcagaagaggaagagaagaaagaggaaagtgctggggaggagcaagctgctaagaag
aaagattga

DBGET integrated database retrieval system