KEGG   Rattus norvegicus (rat): 83614
Entry
83614             CDS       T01003                                 
Symbol
Pias3
Name
(RefSeq) E3 SUMO-protein ligase PIAS3
  KO
K16064  E3 SUMO-protein ligase PIAS3 [EC:2.3.2.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04120  Ubiquitin mediated proteolysis
rno04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    83614 (Pias3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    83614 (Pias3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    83614 (Pias3)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-
     83614 (Pias3)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   83614 (Pias3)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 83614
NCBI-ProteinID: NP_113972
RGD: 708413
Ensembl: ENSRNOG00000021218
UniProt: O70260
Position
2:184232546..184241455
AA seq 628 aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKTLGPSDLSLLSLPPGTSPVGSPSPLASIPPTLLTPGTLLGPKREVDMHPPLP
QPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQLQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILNSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQEGNQSENKKRVEVIDLTIESSSDEEDLPPTKKHCPVTSAAIPALPG
SKGALTSGHQPSSVLRSPAMGTLGSDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQ
HYSPSVITSLDEQDTLGHFFQFRGTPPHFLGPLAPTLGSSHRSATPAPAPGRVSSIVAPG
SSLREGHGGPLPSGPSLTGCRSDVISLD
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggcggagctgggcgaattaaagcacatggtgatgagtttccgggtgtctgagctccag
gtgctccttggcttcgctggcaggaacaagagtgggcggaagcacgaattgctggccaag
gccctgcacctcctcaagtctagctgcgcccccagcgtccagatgaagatcaaagaactt
taccgcaggcgctttccccggaagaccctggggccttccgatctctctttgctctctttg
ccccctggcacctctcctgtaggctcccccagcccccttgcttccattcctcccaccctc
ctgacccctggcaccttgctgggccctaagcgtgaggtggacatgcaccctcctctgccc
cagcctgtgcaccctgacgtcaccatgaaaccactgcccttctacgaagtctacggagag
ctcatccggcccaccacccttgcgtccacctccagtcagaggtttgaggaagcccacttt
acctttgcactcactccccagcagctgcagcagattctcacatccagggaggttctgcca
ggagccaagtgcgattataccatacaagtgcagctcaggttctgtctctgtgagaccagc
tgcccccaggaggactatttcccccctaacctctttgtcaaggttaatgggaaactctgc
cccctgccgggttacctccctccaaccaagaatggagctgagcccaagaggcctagtcgt
ccaatcaacatcacacccctggctcgtctctcagccactgttcccaacaccatagtggtt
aactggtcatctgagtttggacggaattactccttgtctgtgtacctggtgaggcagttg
actgcagggaccctgctacaaaagctcagagccaagggtatccggaatccagaccattcc
cgagcactgatcaaggagaaattgactgctgaccccgacagtgaagtggctactacaagt
ctccgggtgtcactcatgtgcccgctggggaagatgcgcctgactgtcccatgccgcgct
ctcacctgtgcccacctgcagagtttcgatgctgccctttatctacagatgaatgagaaa
aagccaacatggacgtgccctgtgtgtgacaagaaggctccctatgagtcactgattatt
gatggtttattcatggaaattcttaattcctgttcggattgtgatgagatccagttcatg
gaagatggatcctggtgtccaatgaaacccaagaaggaggcatccgaggtttgcccccca
ccagggtatgggctggatggtctccagtatagcccagtccaggagggaaatcagtcagag
aataagaagagggttgaagtcattgacttgacaatcgaaagctcatcagatgaggaagat
ctgccccccaccaagaagcactgccctgttacctcggctgccattccagcccttcctgga
agcaaaggagccctgacctctggtcaccagccgtcttcggtgctgcggagccctgcaatg
ggtacactgggcagtgatttcctgtctagtctcccactacatgagtacccacctgccttc
ccgctgggggctgacatccaaggtttagatttattttctttccttcagactgagagtcag
cactacagcccttcagttatcacttcactagatgagcaggacacccttggccacttcttc
caattccggggaacccctccccacttcctgggcccactggcccccacattggggagctct
caccgcagcgccactccagcacccgctcctggccgtgtcagcagcattgtggctcctggg
agttccttgagggaagggcatggaggacccctgccttccggtccctctttgactggctgt
cggtcagacgtcatttccttggactga

DBGET integrated database retrieval system