KEGG   Rattus norvegicus (rat): 83615
Entry
83615             CDS       T01003                                 

Gene name
Atp6ap1, Atp6s1, C7-1
Definition
(RefSeq) ATPase H+ transporting accessory protein 1
  KO
K03662  V-type H+-transporting ATPase S1 subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04142  Lysosome
rno04145  Phagosome
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05165  Human papillomavirus infection
rno05323  Rheumatoid arthritis
Module
rno_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    83615 (Atp6ap1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    83615 (Atp6ap1)
   04142 Lysosome
    83615 (Atp6ap1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    83615 (Atp6ap1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    83615 (Atp6ap1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    83615 (Atp6ap1)
   05165 Human papillomavirus infection
    83615 (Atp6ap1)
SSDB
Motif
Pfam: ATP-synt_S1
Other DBs
NCBI-GeneID: 83615
NCBI-ProteinID: NP_113973
RGD: 620423
Ensembl: ENSRNOG00000054352
UniProt: O54715
Position
Xq37
AA seq 463 aa
MMAATVVSRIRTGTRWAPVLWLLLSLVAVAAAVAAEQQVPLVLWSSDRDLWAPVADTHEG
HITSDMQLSTYLDPALELGPRNVLLFLQDKLSIEDFTAYGGVFGNKQDSAFSNLENALDL
APSSLVLPAVDWYAISTLTTYLQEKLGASPLHVDLATLKELKLNASLPALLLIRLPYTAS
SGLMAPREVLTGNDEVIGQVLSTLESEDVPYTAALTAVRPSRVARDVAMVAGGLGRQLLQ
TQVASPAIHPPVSYNDTAPRILFWAQNFSVAYKDEWKDLTSLTFGVENLNLTGSFWNDSF
AMLSLTYEPLFGATVTFKFILASRFYPVSARYWFTMERLEIHSNGSVAHFNVSQVTGPSI
YSFHCEYVSSLSKKGSLLVTNVPSLWQMTLHNFQIQAFNVTGEQFSYASDCAGFFSPGIW
MGLLTTLFMLFIFTYGLHMILSLKTMDRFDDRKGPTITLTQIV
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgatggcggcaacagtggtatctcggatacgaaccgggacacggtgggctccagtcctg
tggctgcttctgtcgttggtggcagtggcggcagcagtggctgcggagcagcaggtgcca
ctggtactgtggtcgagtgaccgggacctctgggctcctgtggccgacacacatgagggt
catattaccagcgatatgcagctttctacctacttagaccctgccctggagctgggcccc
cgcaatgtattgctgttcctgcaggacaagctgagcattgaggatttcacagcatacggt
ggtgtgtttggaaataaacaggacagtgccttttctaacctggagaatgccctggacttg
gccccctcctcactggtacttcctgctgtggactggtatgcaatcagcactctgaccacc
tacctacaggagaagcttggagctagtcccttgcatgtggatctagctaccctaaaggag
ctgaagctcaatgccagccttcctgccctgctgctcatccgtctgccctacacagccagc
tccggtctgatggcgcccagggaggtccttacaggtaatgatgaggtcatcggacaggta
ctgagcacacttgagtctgaagatgttccttacaccgcggctcttactgcagtccgccct
tctagagtggcccgtgatgtagccatggtggctgggggtctaggtcgccagctgcttcag
actcaggtggcatcacctgcgatccatcctcctgtgagttacaatgacactgccccaagg
atcctgttttgggcacaaaacttctctgtggcatacaaagacgaatggaaagacttgacc
tccctcacctttggtgtggagaatcttaacttgaccggctccttctggaatgactccttt
gccatgctttcactgacctatgaaccactctttggtgcaacagtgacattcaagttcatt
ctggctagtcgcttctacccagtatctgcccgatattggtttaccatggaacgacttgaa
atccacagcaatggctcggttgcccatttcaatgtttcccaagtcacaggacctagtatc
tattctttccactgtgagtacgtcagcagtctgagcaagaaaggcagtctccttgtgacc
aacgtgccctccctctggcagatgactcttcataacttccagatccaagccttcaatgtg
actggtgaacagttctcctatgctagcgactgtgctggcttcttctctccgggcatctgg
atggggctgctcaccaccctcttcatgcttttcatattcacctatggtctgcacatgata
ctcagcctaaagaccatggatcgctttgatgaccgcaagggccccaccatcactttgacc
cagattgtgtga

DBGET integrated database retrieval system