KEGG   Rattus norvegicus (rat): 83619
Entry
83619             CDS       T01003                                 

Gene name
Nfe2l2
Definition
(RefSeq) nuclear factor erythroid 2-related factor 2
  KO
K05638  nuclear factor erythroid 2-related factor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno05012  Parkinson disease
rno05200  Pathways in cancer
rno05225  Hepatocellular carcinoma
rno05417  Lipid and atherosclerosis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    83619 (Nfe2l2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    83619 (Nfe2l2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    83619 (Nfe2l2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    83619 (Nfe2l2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    83619 (Nfe2l2)
   05418 Fluid shear stress and atherosclerosis
    83619 (Nfe2l2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    83619 (Nfe2l2)
   03029 Mitochondrial biogenesis [BR:rno03029]
    83619 (Nfe2l2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, NF-E2
    83619 (Nfe2l2)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Nuclear respiratory factors
    83619 (Nfe2l2)
SSDB
Motif
Pfam: bZIP_Maf bZIP_1 bZIP_2
Other DBs
NCBI-GeneID: 83619
NCBI-ProteinID: NP_113977
RGD: 620360
Ensembl: ENSRNOG00000001548
UniProt: O54968
Position
3
AA seq 597 aa
MMDLELPPPGLQSQQDMDLIDILWRQDIDLGVSREVFDFSQRQKDYELEKQKKLEKERQE
QLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIQTDTSGSVSYSQVAHIPKQDALYFEDCM
QLLAETFPFVDDHESLALDIPSHVESSVFTTPDQAQSLDSSLETAMTDLSSIQQDMEQVW
QELFSIPELQCLNTENKQQAETTTVPSPEATLTEMDSNYHFYSSIPSLEKEVDSCSPHFL
HGFEDSFSSILSTDDASQLNSLDSNPTLNTDFGDEFYSAFLAEPSGGGSMPSSAAISQSL
SELLGGPIEGCDLSLCKAFNQKHTEGTVEFNDSDSGISLNTSPSRASPEHSVESSIYGDP
PPGFSDSEMEELDSAPGSVKQNGPKAQPTHSSGDTVQPLSPAQGHSAAVHESQCENTTKK
EVPVSPGHQKVPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVDDFNEMMSKE
QFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLGHLKDEREKLLREKGENDR
NLHLLKRKLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDTKKN
NT seq 1794 nt   +upstreamnt  +downstreamnt
atgatggacttggaattgccaccgccaggactacagtcccagcaggacatggatttgatt
gacatcctttggaggcaagacatagatcttggggtaagtcgagaagtgtttgactttagt
cagcgacagaaggattatgagctggaaaaacagaaaaaactcgaaaaggagagacaagag
caactccagaaggaacaggagaaggcctttttcgctcagttacaactggatgaagagacc
ggagaattcctcccaattcagccagcccagcacatccagacagacaccagtggatctgtc
agctactcccaggttgcccacattcccaaacaagatgccttgtactttgaagactgtatg
cagcttttggcagagacattcccatttgtagatgaccatgagtcgcttgccctggatatt
cccagccacgttgagagctcagtcttcaccacccctgatcaggctcagtcactcgatagc
tctctggagacggccatgactgatttaagcagcatacagcaggacatggagcaagtttgg
caggagctattttccattcccgagttacagtgtcttaatacggaaaacaagcagcaggct
gagactaccactgtccccagcccagaggccacactgacagagatggacagcaattaccat
ttttactcatcgatcccctcactggaaaaagaagtggacagctgtagtccacatttcctt
catggttttgaggattcttttagcagcatcctctccacggatgatgccagccagctgaac
tccttagactcaaatcccaccttgaacacagatttcggtgatgaattttactctgctttc
ctagcagagcccagtggcggtggcagcatgccttcctctgctgccattagtcagtcgctc
tctgaacttctgggcgggcccattgagggctgtgatctgtccctgtgtaaagctttcaac
cagaagcacactgaaggcacggtggagttcaatgactctgactccggcatttcactgaac
acaagtcccagccgagcatccccagagcactctgtggagtcttccatttacggagaccca
ccgcctgggttcagtgactcggaaatggaagagctagacagtgcccctggaagtgtcaaa
cagaatggacctaaagcacagccaacacattcttctggggatacagtacagcctctgtcg
ccagctcaagggcacagtgctgctgtgcacgaatcccagtgtgaaaatacaacaaaaaaa
gaagtacctgtgagtcctggtcatcaaaaagtcccattcacaaaagacaaacattcaagc
cgattagaggctcatctcacaagagatgagcttagggcaaaagctctccatattccattc
cctgttgaaaaaatcattaatctccctgttgatgacttcaatgaaatgatgtccaaggag
caattcaacgaagctcagcttgcattaattcgagatatacgcaggagagggaagaataaa
gttgccgctcagaactgtaggaaaaggaagctggaaaacattgtagagctggagcaagac
ttgggccacttaaaagacgagagagaaaaactactcagagaaaagggagaaaacgacaga
aacctccatcttctgaaaagaaaactcagcactttgtatctggaagtcttcagcatgtta
cgtgatgaggatgggaaaccttactctcccagtgagtactctctgcagcagaccagagat
ggcaacgtgttccttgttcccaagagcaagaagccagatacaaagaaaaactag

DBGET integrated database retrieval system