KEGG   Rattus norvegicus (rat): 83626Help
Entry
83626             CDS       T01003                                 

Gene name
Ugcg
Definition
(RefSeq) UDP-glucose ceramide glucosyltransferase
  KO
K00720  ceramide glucosyltransferase [EC:2.4.1.80]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00600  Sphingolipid metabolism
rno01100  Metabolic pathways
Module
rno_M00066  Lactosylceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    83626 (Ugcg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    83626 (Ugcg)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.80  ceramide glucosyltransferase
     83626 (Ugcg)
Glycosyltransferases [BR:rno01003]
 Glycolipid biosynthesis
  Glycosphingolipid
   83626 (Ugcg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_21 Glyco_tranf_2_3 Glyco_trans_2_3 Glycos_transf_2 Chitin_synth_2
Motif
Other DBs
NCBI-GeneID: 83626
NCBI-ProteinID: NP_113983
RGD: 621870
Ensembl: ENSRNOG00000015644
UniProt: Q9R0E0
Position
5q24
AA seq 394 aa AA seqDB search
MALLDLAQEGMALFGFVLFVVLWLMHFMSIIYTRLHLNKKATDKQPYSKLPGVSLLKPLK
GVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIEVCKKLLGKYPNVDARLFIGGKKVG
INPKINNLMPAYEVAKYDLIWICDSGIRVIPDTLTDMVNQMTERVGLVHGLPYVADRQGF
AATLEQVYFGTSHPRSYISANVTGFKCVTGMSCLMRKDVLDQAGGLIAFAQYIAEDYFMA
KAIADRGWKFSMSTQVAMQNSGSYSISQFQSRMIRWTKLRINMLPATIICEPISECFVAS
LIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGTLCFSKLDYAVAWFIRESMT
IYIFLSALWDPTISWRAGRYRLRCGGTAEEILDV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgctggacctggcccaggagggaatggccttgttcggcttcgtgctcttcgtg
gtgctgtggctgatgcatttcatgtccatcatctacacccggttacacctcaacaagaag
gcaacagacaaacagccgtacagcaagctccctggagtctctcttctgaaaccactgaag
ggggtggaccctaacctaatcaacaacttggagacattctttgaactggattatcccaaa
tatgaagtactcctttgtgtacaagatcatgatgatccagccattgaggtgtgtaagaaa
ctgcttggaaaatacccaaacgttgatgctagattatttataggtggtaaaaaggttggc
attaatcctaaaattaataatttgatgccagcatatgaagttgcaaagtatgatctcata
tggatttgtgatagcggaatacgagtcattccagacacattaactgacatggtcaatcag
atgacggagagagtggggctggtccacgggcttccatacgtagctgacagacaaggcttt
gctgccaccttagagcaggtatattttggaacttcacacccaagatcctatatctctgcc
aatgtgaccggcttcaagtgtgtgacggggatgtcttgcttgatgaggaaggatgtgcta
gatcaggcaggagggctcatagcctttgctcagtacattgcggaagattacttcatggcc
aaagcaatagcggaccgaggctggaagttttcaatgtctacgcaagttgccatgcaaaac
tctggttcatactccatttctcagtttcaatccagaatgatcaggtggaccaaattgagg
attaacatgcttcctgccacaataatttgtgagccaatttcagaatgctttgttgccagt
ttaattatcgggtgggcagcccaccacgtgttccgatgggatatcatggttttcttcatg
tgtcactgcctggcatggtttatatttgactacattcaactcaggggtgtccagggtggc
acactatgcttttcaaaacttgattatgctgtggcttggttcatccgcgaatccatgaca
atatacattttcttgtcggcactgtgggaccctactataagctggagagccggtcgctac
aggttgcgctgtggagggacggccgaggagatcctggatgtgtaa

DBGET integrated database retrieval system