KEGG   Rattus norvegicus (rat): 83628
Entry
83628             CDS       T01003                                 
Symbol
Cd82
Name
(RefSeq) CD82 antigen
  KO
K06509  CD82 antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    83628 (Cd82)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    83628 (Cd82)
   04090 CD molecules [BR:rno04090]
    83628 (Cd82)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   83628 (Cd82)
  Exosomal proteins of other body fluids (saliva and urine)
   83628 (Cd82)
  Exosomal proteins of colorectal cancer cells
   83628 (Cd82)
CD molecules [BR:rno04090]
 Proteins
  83628 (Cd82)
SSDB
Motif
Pfam: Tetraspanin DUF1310 DUF6057
Other DBs
NCBI-GeneID: 83628
NCBI-ProteinID: NP_113985
RGD: 69070
Ensembl: ENSRNOG00000000047
UniProt: Q6IN14 F7EV99
Position
3:complement(79387361..79431847)
AA seq 266 aa
MGAGCVKVTKYFLFLFNLLFFILGAVILGFGVWILADKSSFISVLQTSSSSLQVGAYVFI
GVGAITMLMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKQEMGNT
VMDIIQNYSVNASSSREEAWDYVQAQVKCCGWVSPSNWTRNPVLKNSTKTTYPCSCEKTK
EEDNQLIVKKGFCESDNSTASENSPEDWPVHPEGCMEKAQAWLQENFGILLGVCAGVAVI
ELLGLFLSICLCRYIHSEDYSKVPKY
NT seq 801 nt   +upstreamnt  +downstreamnt
atgggggcaggctgtgtcaaagtcaccaagtacttcctcttcctcttcaatctgctgttc
tttatcctgggtgctgtgatcctgggctttggggtgtggattcttgcagacaagagcagc
ttcatttctgtcctacaaacctcatccagctcgctgcaggtgggggcatacgtcttcatt
ggtgtgggcgccatcaccatgctgatgggcttcctgggctgtattggtgctgtcaatgag
gtccgctgcctgctgggtctgtacttcgtcttccttctgctgattcttatagcacaggtg
actgtaggggtcctcttctacttcaatgctgacaagctgaagcaggagatggggaacaca
gtgatggacattattcagaactacagcgtcaatgccagcagcagccgcgaggaggcttgg
gactatgtgcaggcgcaggtgaagtgctgtggctgggtcagcccctccaactggacacgt
aacccggtgctcaagaactctaccaagaccacttacccatgctcctgtgagaagacgaag
gaggaggacaaccagctcattgtgaagaaagggttctgtgagtctgacaacagcaccgca
agtgaaaacagtcctgaggactggcctgtgcacccggaggggtgcatggagaaggctcag
gcgtggctacaggagaacttcggcatccttctgggcgtgtgtgctggtgttgctgtcatt
gagctgctggggttgttcctgtccatatgtttgtgccggtacattcattctgaagattac
agcaaggtccccaagtactga

DBGET integrated database retrieval system