KEGG   Rattus norvegicus (rat): 83629
Entry
83629             CDS       T01003                                 

Gene name
Slc12a2, Bsc2, Nkcc1
Definition
(RefSeq) solute carrier family 12 member 2
  KO
K10951  solute carrier family 12 (sodium/potassium/chloride transporter), member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04970  Salivary secretion
rno04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    83629 (Slc12a2)
   04972 Pancreatic secretion
    83629 (Slc12a2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    83629 (Slc12a2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    83629 (Slc12a2)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     83629 (Slc12a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   83629 (Slc12a2)
SSDB
Motif
Pfam: SLC12 AA_permease AA_permease_N AA_permease_2
Other DBs
NCBI-GeneID: 83629
NCBI-ProteinID: NP_113986
RGD: 620809
Ensembl: ENSRNOG00000015971
UniProt: Q9QX10
Position
18q12.1
AA seq 1203 aa
MEPGPAAPSSGAPRPARDGDAPLTAAGVDLPGTAVLSGREDATAGSQAGGGVRGEGTPAA
GDGLGKPLGPTPSQSRFQVDPVSENAGRAAAAAAAAAAAAAAGAAGKETPAAGKAGTESG
VAKGSEEAKGRFRVNFVDPAASSSADDSLSDAAGVGGDGPNVSSQNGGDTVLSEGSSLHS
GGGSGHHQQYYYDTHTNTYYLRTFGHNTMDAVPRIDHYRHTAAQLGEKLLRPSLGEFHDE
LEKEPFEDGFANGEESTPTRDAVVTYTAESKGVVKFGWIKGVLVRCMLNIWGVMLFIRLS
WIVGQAGIGLSVLVIAMATVVTTITGLSTSAIATNGFVRGGGAYYLISRSLGPEFGGAIG
LIFAFPNAVAVAMYVVGFAETVVELLKEHSILMIDEINDIRIIGAITVVVLLGISVAGME
WEAKAQIVLLVILLLAIADFVIGTFISLDSKKPKGFFGYKSEIFSENFGPDFREEETFFS
VFAIFFPAATGILAGANISGDLADPQSAIPKGTLLAILITTVVYIGIAVSVGSCVVRDAT
GNVNDTITTELTNCTSAACKLNFDFSYCESNTCSYGLMNNFQVMSMVSGFAPLISAGIFS
ATLSSALASLVSAPKIFQALCKDNIYPAFQMFAKGYGKNNEPLRGYILTFLIALGFILIA
ELNVIAPIISNFFLASYALINFSVFHASLAKSPGWRPAFKYYNMWISLTGAILCCIVMFV
INWWAALLTYVIVLGLYIYVTYKKPDVNWGSSTQALTYLSALQHSIRLSGVEDHVKNFRP
QCLVMTGSPNSRPALLHLVHDFTKNVGLMICGHVHMGPRRQAMKEMSIDQAKYQRWLIKN
KMKAFYAPVHADDLREGAQYLMQAAGLGRMKPNTLVLGFKKDWLQADMRDVDMYINLFHD
AFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVNVDYSKKSDQDAFKASG
EKPITQKDEEEDGKTSTQPLLKKESKGPVAPLNVADQKLLEASTQFQKKQGKNTIDVWWL
FDDGGLTLLIPYLLTTKKKWKDCKIRVFIGGKINRIDHDRRAMATLLSKFRIDFSDIMVL
GDINTKPKKENIVAFDDMIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQ
IRLNELLKEHSSTANIIVMSLPVARKGAVSSALYMAWLEALSKDLPPILLVRGNHQSVLT
FYS
NT seq 3612 nt   +upstreamnt  +downstreamnt
atggagcccgggcccgcggcgccctcgtctggcgccccgcggcccgcccgggatggggac
gcgccgctgactgccgccggggtggacctgcccggcacggccgtactctccggtcgagag
gatgctaccgctgggagccaggccggcggcggggtgcgcggagagggaaccccggccgct
ggcgatgggctgggcaaacctctggggcccacccccagccagagccgcttccaggtggac
ccggtttccgagaacgccgggcgggccgcggctgctgcagctgcagcggcggctgcggcg
gctgccggggcagcgggcaaggagacccccgcggctgggaaagccggcactgagagcggc
gtggccaagggcagcgaggaagccaagggccgcttccgcgtgaacttcgtggacccggct
gcctcctcgtcggcggacgacagcctgtcggatgcggcgggagtcggtggcgacgggccc
aacgtgagctcccagaacggcggggacacggtgctgagcgagggcagcagcctgcactcg
ggtggtggcagtggacaccaccagcagtactactatgacacccacaccaacacttactac
ctgcgcaccttcggccacaacaccatggacgcggtgcccaggatcgaccactaccggcac
acggccgcgcagctgggcgagaagctgctccggcccagcctgggagagttccacgatgag
ctggaaaaggaaccttttgaggatggttttgcgaatggagaagaaagtactccaaccaga
gatgctgtggtcacatacactgccgaaagtaaaggagttgtaaagtttggctggatcaag
ggtgttttagtacgatgtatgttgaatatttggggtgtgatgctctttattcgattgtca
tggattgtgggtcaggctggaataggtctctccgttcttgtaatagcaatggccactgtt
gtgacaaccatcacaggattgtctacttcagcaatagctaccaatggattcgtgagagga
ggaggagcatactatttaatctctagaagtctagggccagaatttggcggtgcgattggc
ttgatcttcgcttttcccaatgcagtggcagttgctatgtatgttgttggattcgcagag
actgtagtggagctgcttaaggaacattccatacttatgatagatgaaatcaatgacatc
cgaattattggagccattacagtggtggttcttctgggcatctcagtggccggaatggag
tgggaagcaaaggctcagatcgtccttctggtgattcttcttctggccatcgctgacttc
gtcataggaacatttatctcactggacagcaagaagcccaagggtttctttggctataaa
tctgaaatatttagtgagaactttggaccggattttcgagaagaagagactttcttttct
gtattcgccatcttttttcctgctgcaactggtattctagctggggcgaacatctcgggt
gaccttgcagatcctcagtcagccatacccaaaggaacgctcttagccattttgattacg
acagtggtttacataggaatcgcagtgtctgtaggttcttgtgttgtccgggatgccact
gggaacgttaatgacaccattacaacagagctaactaactgtacttctgcagcctgcaaa
ttaaactttgacttttcctactgtgaaagcaacacctgttcttatgggctaatgaacaac
tttcaggtgatgagcatggtgtcaggatttgcacccctgatctctgcgggtatcttttca
gccacactctcatcagcactggcatctcttgtgagtgctcccaaaatatttcaggctcta
tgtaaggacaatatctacccagctttccagatgtttgcgaaaggttatggaaaaaataat
gaacctcttcgtggttacatcttaacattcttaattgcacttggattcatcttaattgct
gaattgaatgtcattgctccaattatctctaatttctttctcgcatcatacgccttaatc
aacttttctgtattccatgcgtcacttgcaaagtctccagggtggcgtcctgcgttcaag
tactacaacatgtggatctcccttactggagcgattctctgctgcatagtgatgttcgtc
attaactggtgggctgcactgctcacatatgtgatagttcttggactgtacatttatgtc
acttacaaaaagccagatgtgaactggggatcctccacacaagcgctgacttacctcagc
gcactgcagcattcaatccgtctttccggggtggaggaccatgtgaaaaacttcaggcca
cagtgtcttgtaatgacaggttctccaaactcacggcctgctttactgcatcttgttcat
gacttcacgaaaaatgttggtttaatgatctgtggccatgtgcatatgggtccccgaaga
caagctatgaaagagatgtccattgatcaagccaaatatcagcgatggctcattaaaaac
aaaatgaaggctttctacgctccggttcacgcagatgacttgcgggaaggtgcacagtac
ctgatgcaggctgctggacttggtcgtatgaaaccaaacacacttgtcctcggatttaag
aaagattggttacaagcagatatgagggatgtggatatgtatataaacttatttcatgat
gcttttgacatacagtatggagttgtggtcattcgcctaaaggaaggactggatatatca
cacctccaaggacaagaagaattattgtcatcacaagaaaagtcacctggtaccaaggat
gtggtagtaaatgtggactacagtaagaagtcagatcaagatgctttcaaagcatctggt
gaaaaacctattacacagaaagatgaggaagaggatggcaagacttcaactcagccactg
ttgaaaaaagaatccaagggccccgtggcacctttaaatgtagctgaccaaaagcttctt
gaagctagcacacagtttcagaaaaaacaagggaagaatactatagatgtctggtggctt
tttgatgatggaggtttgaccttgttgataccctatcttctgacaaccaagaaaaagtgg
aaagattgtaagatccgagtattcattggtggaaagataaacagaatagaccatgaccgg
agagcgatggctactttactcagtaaattccgaatagacttctccgatatcatggtccta
ggagacatcaacaccaaaccaaaaaaggaaaacatcgtcgcttttgatgacatgattgag
ccatacagacttcacgaggatgataaagagcaggatattgcagacaaaatgaaagaggat
gagccctggcgcatcacagacaacgagctggagctctacaagaccaagacatatcggcag
atcaggttaaatgaattattaaaggagcattcaagcacagctaatattattgtcatgagt
cttccagttgcccggaagggtgctgtgtccagcgcgctgtacatggcttggttagaagct
ctgtctaaggacctgccaccaatcctgctggttcgtgggaatcatcagagcgtccttacc
ttctactcttaa

DBGET integrated database retrieval system