KEGG   Rattus norvegicus (rat): 83631Help
Entry
83631             CDS       T01003                                 

Gene name
Dedd, Deft
Definition
(RefSeq) death effector domain-containing
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: DED
Motif
Other DBs
NCBI-GeneID: 83631
NCBI-ProteinID: NP_113988
RGD: 620050
Ensembl: ENSRNOG00000003779
UniProt: Q9Z2K0
Position
13q24
AA seq 318 aa AA seqDB search
MAGLKRRASQVWPEERVEQEHGLYSLHRMFDIVGTHLTHRDVRVLSFLFVDVIDDHERGL
IRNGRDFLLALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKKRRAVCPDLVDKYLEE
TSIRYVTPRALSDPEPRPPQPSKTVPPHYPVVCCPTSGSQMCSKRPARGRTTLGSQRKRR
KSVTPDPKEKQTCDIRLRVRAEYCQHETALQGNVFSNKQDPLERQFERFNQANTILKSRD
LGSIICDIKFSELTYLDAFWRDYINGSLLEALKGVFITDSLKQAVGHEAIKLLVNVDEED
YELGRQKLLRNLMLQALP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcctaaagaggcgggcaagccaggtgtggcccgaagagcgcgttgagcaggaa
catgggctctacagcctccaccgcatgtttgacatcgtgggcacccacctgacacacaga
gatgttcgagtgctttccttcctttttgttgatgttattgatgaccatgaacgaggactt
atccgaaatggacgtgacttcttgttggcactggagcgccagggccgctgtgatgagagt
aactttcgccaggtgctgcagctgctgcgtatcatcactcgccatgacttgctgccctat
gttactctcaagaagagacgggctgtgtgccctgatcttgtagacaagtatctggaggaa
acatcaattcgctatgtgacccccagagccctcagcgatccagaaccgaggcctccccag
ccctctaaaacagtgcctccccactatcctgtggtgtgctgccccacttcgggttctcaa
atgtgtagtaagcggccagcccgagggagaaccacacttgggagtcagagaaaacgccgg
aagtcagtgactccagacccgaaggaaaagcagacatgtgacatcaggctgcgagttcgg
gcggaatactgccagcacgagactgctctgcaaggcaatgtcttctctaataagcaggac
ccacttgagcgccagtttgagcgctttaaccaggccaacactatcctcaagtcccgggac
ctgggctccatcatctgtgacatcaagttctctgagctcacctacctcgacgcattctgg
cgagactacattaatggctcattattagaggcactgaaaggcgttttcatcacagactct
ctcaagcaagctgtgggccatgaagccatcaagctgctggtgaacgtggatgaagaagac
tatgaactgggccgacagaaactcctgaggaacttgatgctgcaagcattaccctga

DBGET integrated database retrieval system