KEGG   Rattus norvegicus (rat): 83632Help
Entry
83632             CDS       T01003                                 

Gene name
Deaf1, NUDR
Definition
(RefSeq) DEAF1 transcription factor
  KO
K23041  deformed epidermal autoregulatory factor 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    83632 (Deaf1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     83632 (Deaf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAND zf-MYND
Motif
Other DBs
NCBI-GeneID: 83632
NCBI-ProteinID: NP_113989
RGD: 620671
Ensembl: ENSRNOG00000017960
UniProt: F1LQ17
Position
1q41
AA seq 565 aa AA seqDB search
MEDSDSAAKQLGLAEAAAVAAAAAVAAAAAAAAESEAEEPVLSRDEDSEEDADSEAERET
RRVTAVAVMAAESGHMDMGTEALPSPDEAAAAAAFAEVTTVTVANVGSSADNVFTTSVAN
AASISGHVLSGRTALQIGDSLNTEKATLIVVHTDGSIVETTGLKGPAAPLTPGPQSPPTP
LAPGQEKGGTKYNWDPSVYDSELPVRCRNISGTLYKSRLGSGGRGRCIKQGENWYSPTEF
EAMAGRASSKDWKRSIRYAGRPLQCLIQDGILNPHAASCTCAACCDDMTLSGPVRLFVPY
KRRKKENELPTTPVKKDSPKNITLLPATAATTFTVTPSGQITTSGALTFDRASTVEATAV
ISESPAQGDVFAGATVQEAGVQPPCRVGHPEPHYPGYQDSCQIAPFPEAALPTSHPKIVL
TSLPALAVPPSTPTKAVSPTVVSGLEMSEHRSWLYLEEMVNSLLNTAQQLKTLFEQAKQA
SSCREAAVTQARMQVDAERKEQSCVNCGREAMSECTGCHKVNYCSTFCQRKDWKDHQHVC
GQSASVTVQADDVHVEESVIEKVTV
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggaggactcggactcggcggcaaaacagctgggcctggccgaggcggcagcggtggcg
gccgctgccgctgtggcggcggccgccgcggccgcagcggaaagcgaggcggaggagccg
gtgttaagcagagacgaggactcggaggaggacgcagactccgaggcggagcgcgagacg
cggcgggtcacggctgtggcggtgatggcggccgaatctgggcacatggatatgggtacc
gaggctctgcccagccctgatgaggccgccgccgccgccgcctttgcagaagtgaccaca
gtgactgtggccaacgtggggtcctctgcagataacgtcttcacaacatcagtggcaaat
gcagcctcgatatcaggacatgtcctgtctggtaggacagccctgcagatcggggacagc
ctgaacactgagaaagccacactaatagttgtacacacagatgggagcattgtggaaacc
accgggctgaagggcccagcagcacctctcaccccaggtcctcagtctcctcctacccca
ctggcacctggccaggagaaaggtggtaccaagtacaactgggacccttcggtgtatgac
agcgagctgcctgtgcgctgtcggaacatcagtggcacgctctacaagagtcggctcggc
tcaggtggccgggggcggtgtatcaagcagggagaaaactggtacagcccaaccgagttt
gaagccatggcaggaagagccagcagcaaggactggaagagaagcatccgctatgcgggc
agacccctgcagtgcctcatccaggatggtattttgaaccctcacgctgcctcctgcacc
tgtgctgcctgttgcgatgacatgactctaagtggccctgtcaggctcttcgtcccctat
aaaaggcgcaagaaagagaatgagctgcccacgactccagttaagaaggattcccccaag
aacatcacgctgctccctgccacggcggccaccaccttcactgtgacaccctcaggacag
atcactacctctggagcactaacctttgaccgagcatccactgtggaggccactgctgtc
atctctgagagcccagcccaaggggatgtctttgcaggagccacagtgcaagaggcaggc
gtgcagcccccctgcagggttggccaccctgaaccccactaccctggctatcaggacagc
tgccagatcgccccgtttccagaagctgcattgccaacatcacatcccaaaattgtcctg
acatcgctgcccgccttggccgtgccgccctccacccccaccaaagctgtctctcccacc
gtggtcagtgggctggagatgtcagagcatcggagctggctgtacctggaagagatggtc
aactccctcctcaacacagcccagcagctgaagacgttgtttgaacaagccaagcaggcg
agctcttgcagggaagctgctgtgacccaggcgagaatgcaggttgatgcagagaggaag
gagcagtcatgtgtcaactgcggccgggaggccatgagtgagtgcaccggctgccacaag
gttaactactgctctacgttctgccagcgcaaggactggaaagaccatcagcatgtatgt
ggccagtcagcatctgtcactgtccaggctgatgacgtccatgttgaagaaagtgtgata
gaaaaagttactgtctga

DBGET integrated database retrieval system