KEGG   Rattus norvegicus (rat): 83681
Entry
83681             CDS       T01003                                 

Gene name
Cish, Cis
Definition
(RefSeq) cytokine inducible SH2-containing protein
  KO
K04701  cytokine inducible SH2-containing protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04630  JAK-STAT signaling pathway
rno04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    83681 (Cish)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    83681 (Cish)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    83681 (Cish)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    83681 (Cish)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     83681 (Cish)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   83681 (Cish)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 83681
NCBI-ProteinID: NP_113992
RGD: 69261
Ensembl: ENSRNOG00000029543
UniProt: B1WBX9
Position
8q32
AA seq 257 aa
MVLCVQGSCPLLVVEQIGQRPLWAQSLELPGPAMQPLPTGAFPEEVTEETPVQSENEPKV
LDPEGDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCTADTRSDSPDPAP
TPALPVPKPDAPGDPVLPIPVATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVTDVDCL
PLPRRMADYLRQYPFQL
NT seq 774 nt   +upstreamnt  +downstreamnt
atggtcctctgcgtacagggatcttgtcctttgctggttgtggagcaaattgggcagcgg
cctctgtgggcccagtccctggagctgcccgggccagccatgcagcccttacccactggg
gcattcccagaggaggtgacagaggagacccctgtccagtcagagaatgaaccgaaggtg
ctagaccctgagggagatctgctgtgcatagccaagacgttctcctacctccgggaatct
ggttggtactggggttccattacagccagtgaggcccggcagcatctacagaagatgccg
gagggcacattcctcgtgcgagacagcacccaccccagctacctgtttacattgtcagtc
aaaaccacccgtggccccaccaatgtacgcatcgagtatgccgactctagcttccgactg
gactccaattgcttgtcgagacctcgaatcctggccttcccagatgtggtcagccttgtg
cagcattacgtggcctcctgtacggctgacacccggagtgacagcccagatcctgctccc
accccagccctgcctgtgccgaagccagatgcacctggtgacccagtactgcctatcccc
gtggctactgctgtgcacctgaaattggtgcagccctttgtgcgcaggagcagcgcccgc
agcttacaacacctgtgtcggctagtcatcaaccgactggtgaccgatgtggactgccta
cccctgccccggcgcatggccgactacctccgacagtacccgttccagctctga

DBGET integrated database retrieval system