KEGG   Rattus norvegicus (rat): 83683Help
Entry
83683             CDS       T01003                                 

Gene name
Gpr6
Definition
(RefSeq) G protein-coupled receptor 6
  KO
K04313  G protein-coupled receptor 6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    83683 (Gpr6)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    83683 (Gpr6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 83683
NCBI-ProteinID: NP_113994
RGD: 70939
Ensembl: ENSRNOG00000049580
UniProt: P51651
Position
20q12
AA seq 363 aa AA seqDB search
MNASAAALNESQVVAVAAEGAAAAATAAGTPDTSEWGPPAASAALGGGGGPNGSLELSSQ
LPAGPSGLLLSAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADL
LAGCGLILHFVFQYVVPSETVSLLMVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSR
RTLLGVHLLLAATWTVSLGLGLLPVLGWNCLADRASCSVVRPLTRSHVALLSTSFFVVFG
IMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYC
VVGSQEDPAIYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLFCGCFQSKVPFRSRSP
SEV
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctagcgccgccgcgctcaacgagtcccaggtggtggcagtagcggccgaggga
gcggcagctgcggctacagcagcagggacaccggacaccagcgaatggggacctccggca
gcatccgcggcgctgggaggcggcggaggacctaacgggtcactggagctgtcttcgcag
ctgcccgcaggaccctcaggacttctgctttcggcagtgaatccctgggatgtgctgctg
tgcgtgtcggggactgtgatcgcaggcgaaaatgcgctggtggtggcgctcatcgcatcc
actcccgcgctgcgcacgcccatgtttgtgctcgtgggtagtctggccactgctgacctg
ctggcgggctgtggcctcatcctacacttcgtgttccagtacgtggtgccctcggagact
gtgagcctgctcatggtgggcttcctggtggcgtccttcgccgcctcagtcagcagcctg
ctcgctatcacagtggaccgttacctgtccctttacaacgcgctcacctactactcgcgc
cggaccctgttgggcgtgcacctcttgctagcagccacctggacagtgtccctcgggttg
gggttgctgcccgttctaggctggaactgcttggctgaccgcgcgtcctgcagcgtggtg
cgccccctgacacgcagccatgtggcgttgctctccacttccttctttgtggtctttggc
atcatgctacacttgtacgtgcgcatctgccaggtggtctggcgccacgcccaccagatc
gctttgcaacagcactgcctagcaccaccacacttagcagccaccagaaagggtgtggga
actttggccgtggtgctaggcacttttggggccagctggctgcccttcgccatctattgt
gtggtgggtagccaagaggacccggccatctacacctatgccaccctgctgcctgccacc
tataactccatgatcaatcccatcatctatgccttccgcaaccaggagatccagcgtgcc
ttgtggctcctgttctgtggctgtttccaatccaaagtgcccttccgctccaggtccccc
agtgaggtctga

DBGET integrated database retrieval system