KEGG   Rattus norvegicus (rat): 83686Help
Entry
83686             CDS       T01003                                 

Gene name
Cngb1, Gm1959
Definition
(RefSeq) cyclic nucleotide gated channel beta 1
  KO
K04952  cyclic nucleotide gated channel beta 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04740  Olfactory transduction
rno04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    83686 (Cngb1)
   04022 cGMP-PKG signaling pathway
    83686 (Cngb1)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    83686 (Cngb1)
   04740 Olfactory transduction
    83686 (Cngb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    83686 (Cngb1)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   83686 (Cngb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cNMP_binding
Motif
Other DBs
NCBI-GeneID: 83686
NCBI-ProteinID: NP_113997
RGD: 621809
Ensembl: ENSRNOG00000031773
UniProt: O35788
Position
19p13
AA seq 1339 aa AA seqDB search
MLGWVQRVLPQPPGTPQKTEEGAGPQPETESKPEANPQPEPEVQPEPEPEPEPEPEPEPA
PEEAAPEVQTLPPEEPVEGEDVAEAGPSLQETQEADPPQPTSQAQVAVVKVNRPSSWMLS
WFWKGMEKVVPQPVYSSSGGQNLAAGEGGPDQDGAQTLEPCGTGDPGSEDGSDKTSKTQD
TEPSLWLLRWLELNLEKVLPQPPTPSQAWKVEPEGAVLEPDPPGTPMEVEPTENPSQPNP
GPVEPEEEPAAEPQPGFQASSLPPPGDPVRLIEWLLHRLEMALPQPVLHGKAAEQEPSCP
GTCDVQTISILPVEQAEHDLVLEDVDSCWEDTQQEDGASLQETELAPIYEDESEAMVEMP
RELPQIQEQQEEENEEKEEEEEEKEEKEEKEEEEEKEEEEKREEEKKKEKEEEKKEKEEE
ENGEEEEKEEKEEKEEEEGKEEKEEKEEKEEKEEEEKEEKEEEEKEEKEEEEEEEEEEEE
EEPIVLLDSCLVVQADVDQCQLERAQPETASIQELPEEEEEKEEEKKEEEEEKEEEEEKE
EEEEKEEEGEATNSTVPATKEHPELQVEDTDAEAGPLIPEETIPPPERPPVSPAKSDTLA
VPSAATHRKKLPSQDDEAEELKALSPAESPVVAWSDPTTPQEADGEDRAASTASQNSAII
NDRLQELVKMFKERTEKVKEKLIDPDVTSDEESPKPSPAKKAPDSAPAQKPAEAEAAEEE
HYCDMLCCKFKRRPWKMYQFPQSIDPLTNLMYILWLFFVVLAWNWNCWLIPVRWAFPYQR
ADNIHLWLLMDYLCDFIYLLDITVFQMRLQFVKGGDIITDKKEMRNNYLKSQRFKMDLLC
LLPLDFLYLKLGVNPLLRLPRCLKYMAFFEFNNRLEAILSKAYVYRVIRTTAYLLYSLHL
NSCLYYWASAFQGIGSTHWVYDGVGNSYIRCYYWAVKTLITIGGLPDPQTLFEIVFQLLN
YFTGVFAFSVMIGQMRDVVGAATAGQTYYRSCMDSTVKYMNFYKIPRSVQNRVKTWYEYT
WHSQGMLDESELMVQLPDKMRLDLAIDVNYNIVSKVALFQGCDRQMIFDMLKRLRSVVYL
PNDYVCKKGEIGREMYIIQAGQVQVLGGPDGKAVLVTLKAGSVFGEISLLAVGGGNRRTA
NVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKARRMLRNNNKPKEEKSVLILPPRAG
TPKLFNAALAAAGKMGPRGAKGGKLAHLRARLKELAALEAAARQQQLLEQAKSSQEAGGE
EGSGATDQPAPQEPSEPKEPPEPPAPSSPPPASAKPEGSTEEAAGPPEPSVRIRVSPGPD
PGEQTLSVEMLEEKKEEVE
NT seq 4020 nt NT seq  +upstreamnt  +downstreamnt
atgttgggctgggtccaaagggtgctgcctcagcctccggggaccccccagaagactgaa
gagggagcaggaccacagccagaaacagagtcaaagcctgaggcaaatccacaacccgag
ccagaggttcagccggaaccagagccggaaccggaaccagagccggaaccggaaccagca
cctgaagaggctgcaccagaggtccagaccctgccaccagaggaaccagtggaaggagag
gatgtggctgaggctggccctagccttcaagagacccaggaagctgaccctcctcagccc
acctcccaggcccaggttgctgttgtcaaggtgaacaggcccagctcctggatgttgagc
tggttctggaagggcatggagaaggtcgtgccacagcctgtctacagcagcagtgggggc
cagaacctggctgccggagagggaggcccagatcaggatggagcacagaccctggagccc
tgtggcactggagacccagggtctgaagatggctcagataaaacttccaagactcaagac
actgagcccagcctgtggctactcaggtggcttgagctgaatctggagaaggtgctacct
cagccccctacgccttcccaggcctggaaagttgaacctgagggtgctgtcttggaacca
gatcctccaggaacccctatggaagtggagcccacagagaacccctcccagcctaatcct
ggacccgtggagcctgaggaggagccagccgcagagccccagcctggctttcaagcctct
tccctgccaccacctggggaccctgtcaggctgatcgagtggctcctacacaggctggag
atggccctgcctcagcctgtgctccatgggaaggctgcagagcaggagcccagctgccct
gggacgtgtgacgtacagaccatcagcatcctccctgtggaacaggcggaacatgatctt
gtcctcgaggatgtggactcttgctgggaggacacccagcaggaagatggtgccagcctg
caggagacagagttggctcccatttatgaagacgagagtgaggccatggtggagatgccc
agggagctgccacagattcaagagcagcaggaagaggagaatgaagagaaagaagaagag
gaagaagagaaggaagagaaggaagagaaggaagaggaggaagagaaggaagaggaggag
aagagggaggaagagaagaagaaagagaaggaagaggagaagaaagagaaggaagaagag
gagaacggggaggaagaagagaaggaagagaaggaagaaaaggaagaggaggaggggaag
gaagagaaggaagagaaggaagagaaggaagaaaaagaagaggaggagaaggaagaaaaa
gaagaggaggagaaggaagaaaaagaagaggaggaagaggaagaggaggaagaggaggaa
gaggagcctattgtcctgctggatagctgtttggtggtgcaggctgatgtggaccagtgc
cagctagaaagggcacagccagagacagcatcgatccaggagttaccagaagaagaagag
gagaaggaggaagagaagaaggaggaggaagaggagaaggaggaggaggaagagaaggaa
gaggaagaggagaaggaggaggagggggaggccacaaactcaacagtaccagccacgaaa
gagcacccggagctccaggtggaagacacagatgccgaagctggccccctcatcccagag
gagacgatcccgccacctgagagaccaccagtgtctcccgccaagtctgacaccctcgcg
gttcccagcgcagcaacccacaggaagaagctaccttctcaggatgatgaggctgaagaa
ctcaaggccctgtcaccggctgagtccccagtggttgcctggtcagaccccaccacccca
caggaggctgatggcgaggaccgtgcggcctccacagccagccagaacagtgccatcatc
aacgaccggctccaggagctggtgaagatgttcaaggagcggacagagaaggtgaaggag
aagctcattgaccctgacgtcacctccgatgaggagagccccaagccctccccagccaag
aaggccccagactcagccccagcccagaagccggcggaggcagaggcggcagaggaggag
cactactgtgacatgctctgctgcaaatttaagcgcaggccctggaagatgtaccagttc
ccccagagcatcgacccactgaccaacctcatgtacatcctgtggctgttcttcgtggtg
ctggcctggaactggaactgctggctgattcctgtgcgctgggccttcccgtaccagcgg
gcagacaacatccacctctggctgctcatggactacttgtgcgacttcatctacctcctg
gacatcaccgtgttccagatgcgtctccagtttgtcaaaggcggggacatcattacagat
aagaaggagatgcgtaataattacctgaagtctcaacgatttaagatggacttgctctgc
cttttgcctttggattttctctacttgaaacttggcgtgaacccccttcttcgcctgccc
cgctgcctgaagtacatggccttctttgagtttaataaccgtctggaagccatcctcagc
aaagcctacgtttacagggttatcaggaccaccgcctacctgctgtatagcttgcatctc
aactcctgtctttactactgggcgtcggccttccagggcatcggttccactcactgggtt
tatgacggcgtggggaacagctacattcgatgctactactgggctgtgaaaactctcatc
accatcggaggactgcccgacccccagacgctctttgagatcgtcttccagctgctgaat
tattttacaggtgtcttcgctttctctgtgatgattggacagatgagagatgtggtgggg
gccgccacggcagggcagacgtactaccgcagctgcatggacagcacggtgaagtacatg
aacttctacaagatccccaggtctgtgcagaaccgcgtcaagacctggtacgaatacacc
tggcactcacaaggcatgctggatgagtcagagctgatggttcagcttccggacaagatg
cgtctggacctggccattgacgtaaactacaacattgtcagcaaagtggcgctcttccag
ggctgcgaccggcagatgatcttcgacatgctcaagcgacttcgctcagtcgtctaccta
cccaatgactatgtgtgcaagaagggggagattggccgagagatgtatattatccaggcg
gggcaggtgcaggtgctgggcggcccagatggaaaggctgtcctggtgacactcaaagcc
ggatcggtgtttggagagataagcttgctggctgtcgggggcggtaacaggcgcacggcc
aatgtggtggcccacggcttcaccaatctcttcattctggataagaaggacttgaatgag
attttggtgcattaccctgaatctcagaagctgctccggaagaaggccaggcgcatgctc
agaaacaacaacaaacccaaggaggagaagagtgtgctcatcctgcccccacgtgcgggc
accccgaagctcttcaatgctgccctggctgcagcaggaaagatgggccccaggggagcc
aagggcggcaagctcgcccacctgagagccaggctcaaagaactggctgcactggaggca
gccgcacgacagcagcagctgctggaacaggccaagagctcgcaagaagccgggggagag
gagggctctggagccacagaccaacctgcaccccaggagccgtcagagcccaaggagccc
ccggagcccccagccccgagttctccaccgccagcctcagcaaagcccgagggaagcacg
gaggaggccgcagggccgccggagccttcagtgaggatccgtgtgagtccaggccctgat
cccggggaacagacactatcggtggagatgctggaagagaagaaggaggaggtggagtga

DBGET integrated database retrieval system