KEGG   Rattus norvegicus (rat): 83689
Entry
83689             CDS       T01003                                 

Gene name
Cd164
Definition
(RefSeq) sialomucin core protein 24 precursor
  KO
K06546  CD164 antigen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    83689 (Cd164)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    83689 (Cd164)
CD molecules [BR:rno04090]
 Proteins
  83689 (Cd164)
SSDB
Motif
Pfam: MGC-24 DUF4366
Other DBs
NCBI-GeneID: 83689
NCBI-ProteinID: NP_114000
RGD: 70942
Ensembl: ENSRNOG00000000304
Vega: OTTRNOG00000001099
UniProt: Q9QX82
Position
20
AA seq 195 aa
MSGASRGLFWAATCLAALCLSAAQSNSSASPNVTDPPTTTSKVVPTTLTTTKPPETCESF
NSCVSCVNATLTNNITCVWLDCHEANKTYCSSELVSNCTQKTSTDSCSVIPTTPVPTNST
AKPTTRPSSPTPTPSVVTSAGATNTTVTPTSQPERKSTFDAASFIGGIVLVLGVQAVIFF
LYKFCKSKERNYHTL
NT seq 588 nt   +upstreamnt  +downstreamnt
atgtcgggcgcctcccgcggactgttctgggccgccacctgcctcgccgcgctctgcctg
tcggccgcgcagagcaacagcagcgcatctcccaacgtgactgacccgccgaccacgacc
agcaaagtggtcccgacgacgctcaccaccaccaagccgccagaaacctgtgagagcttc
aacagctgtgtttcctgtgtcaacgccaccttgactaataatattacctgcgtctggcta
gattgccatgaagcaaataagacctattgttcaagtgaattagtaagtaattgtacccag
aagaccagtactgactcctgttctgtaatacctaccaccccagtgccaaccaattctaca
gctaagcctacaactcggccttcctctcctacacctactccctcagttgtcacatcagca
ggtgcaacaaataccactgtgactccaacctcacagcctgagcggaagtccacctttgat
gcagccagcttcattggaggaatcgtccttgtcttgggtgtgcaggctgtaattttcttt
ctctataaattctgcaaatctaaagaacgaaattaccatactctgtaa

DBGET integrated database retrieval system