KEGG   Rattus norvegicus (rat): 83712Help
Entry
83712             CDS       T01003                                 

Gene name
Rbbp7
Definition
(RefSeq) RB binding protein 7, chromatin remodeling factor
  KO
K11659  histone-binding protein RBBP7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    83712 (Rbbp7)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     83712 (Rbbp7)
  Chromatin remodeling factors
   NuRD complex
    83712 (Rbbp7)
   NuRF complex
    83712 (Rbbp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAF1C_H4-bd WD40 ANAPC4_WD40 Capsid_NCLDV
Motif
Other DBs
NCBI-GeneID: 83712
NCBI-ProteinID: NP_114004
RGD: 620125
Ensembl: ENSRNOG00000005157
UniProt: Q71UF4
Position
Xq14
AA seq 425 aa AA seqDB search
MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDY
ALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKI
NHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGY
GLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHES
LFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALW
DLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAED
GPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSEL
EGQGS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtaaagagatgtttgaagatactgtggaggagcgtgtcatcaacgaagaatat
aaaatctggaagaagaatacaccgtttctgtatgacctggttatgacccatgctcttcag
tggcccagtcttaccgttcagtggcttcctgaagtgactaaaccagaaggaaaggattat
gcccttcattggctagtgctgggtacccatacatctgatgagcagaatcatctggtggtt
gctcgagttcatattcccaatgatgatgcacagtttgatgcttcccattgtgacagtgac
aagggagaatttggtggctttggttctgtaacaggaaaaattgaatgtgaaattaaaatt
aatcatgaaggagaagtaaatcgcgctcgttatatgccacagaacccacacatcattgcc
acaaaaacaccatcttctgatgttttggtttttgactatacaaaacaccctgcaaaacca
gatccaagtggagagtgtaatcctgatcttagattaagaggtcaccaaaaggaaggctat
ggtctctcctggaattctaatttgagtggacatctcctgagtgcatctgatgaccatact
gtctgcctctgggatataaatgcaggaccaaaggaaggcaaaattgtggatgctaaagca
atctttactggccactcagctgttgtagaggatgtggcctggcatctgctgcatgagtcc
ttgtttggatctgttgctgatgatcagaaacttatgatatgggacaccagatccaatact
acttctaagcccagccatttggtggatgcacacactgcggaggtcaactgcctctcattc
aatccctacagcgagtttattctggcaactggctctgcagataagactgtagctttatgg
gacctgcgtaatctgaaactaaaactccacacctttgaatcccataaggatgaaattttt
caggtccactggtctccacataatgaaactattctggcttcaagtggtactgatcgccgc
ctgaatgtgtgggatttaagtaaaattggagaagaacaatcagcagaagatgcagaggat
gggcctccagagctcctgtttattcatggaggacacactgccaagatttctgacttcagt
tggaaccccaatgaaccttgggtcatttgctctgtgtctgaagataacatcatgcagata
tggcaaatggctgaaaatatttacaatgatgaagagtcagatgtcacgacatcggaactg
gaggggcaaggatcttaa

DBGET integrated database retrieval system