KEGG   Rattus norvegicus (rat): 83717
Entry
83717             CDS       T01003                                 

Gene name
Omd, OSAD
Definition
(RefSeq) osteomodulin
  KO
K08124  osteomodulin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    83717 (Omd)
Proteoglycans [BR:rno00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class II
    83717 (Omd)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRRNT LRR_5 LRR_6 LRR_9
Other DBs
NCBI-GeneID: 83717
NCBI-ProteinID: NP_114005
RGD: 621818
Ensembl: ENSRNOG00000039560
UniProt: G3V7Y2
Position
17p14
AA seq 423 aa
MGFLSPIYVLFFCFGVRVYGQYEAYQWDEDYEQEPSEDYEPEFQFHQNIEYGAPFYQNIL
GCAKECFCPTNFPTSMYCDNRKLKTIPDIPMHIQQLNLQFNDIEAVTADSFINATHLKEI
NLSHNKIKSQKIDYGVFAKLSNLQQLHLDHNNLEEFPFPLPKSLERLLLGYNEISTLPTH
AMDGLVNVTMLDLCYNHLSDSTLKGKILSKLEKLMQLNLCNNRLESMPPGLPSSLMYLSL
ENNSISSIPEDYFQKLPKLHALRISHNKLEDIPYDIFNLSNLIELNVGHNKLKQAFYIPR
NLEHLYLQNNEIQSINVTMMCPSLDPLHHHHLTYLRVDQNKLKEPISSYIFFCFPRIHSI
YYGEQRSTNGETIQLKTQVFRRYQDEEEEEEDDSQDHTLEGQEETEEHFNSHYYEMQAWQ
NTI
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgggctttttaagtccaatatatgtcctcttcttctgttttggagttagagtatacggc
caatatgaagcttaccagtgggatgaagattatgagcaagagccaagtgaggattatgag
ccagaattccagtttcaccaaaatatcgaatatggagctcccttttatcagaatatttta
ggttgtgctaaggaatgcttctgtccaactaactttccaacatcaatgtactgtgacaac
cgcaaactcaagactatcccagatattccaatgcacattcagcaactcaaccttcagttc
aatgatattgaggctgtgactgcagattcattcatcaatgcaactcatcttaaagaaatt
aaccttagccacaacaaaattaaatctcaaaagattgattatggtgtgtttgctaaactt
tcaaatctacagcaacttcatctagatcacaataacttagaagaatttccatttcctctt
cctaaatctctggaaagactccttcttggttataatgaaatctctacacttccaacacat
gccatggatgggctggtaaatgtcactatgcttgacctctgctataaccatctctctgac
tccacgttaaaaggaaagattctttccaaactggaaaagctcatgcagcttaacctgtgc
aataacaggttagagtcaatgccccctgggttgccgtcatcacttatgtatctatcttta
gaaaataattcaatttcatctataccagaggattactttcagaaacttccaaaacttcat
gctctaagaatatcacacaacaaacttgaagacattccatatgacatctttaatctttcc
aatcttatagaactcaatgttggacataacaaactgaagcaagcattctacattccaagg
aatttggaacatctatacctacaaaataatgaaatacaaagcatcaatgtgacaatgatg
tgtccttctcttgatccattacaccatcaccatttaacataccttcgtgtggaccaaaat
aagctgaaggaaccaataagttcatatatcttcttctgcttccctcggatacacagtatt
tattatggtgagcagaggagcactaatggtgaaacaatacaactgaagacccaagttttc
aggcgctatcaagatgaggaagaggaagaggaagacgacagtcaggaccacactcttgag
ggtcaagaagaaacagaagagcactttaattctcattactatgaaatgcaagcatggcaa
aatactatatag

DBGET integrated database retrieval system