KEGG   Rattus norvegicus (rat): 83718Help
Entry
83718             CDS       T01003                                 

Gene name
Clic4
Definition
(RefSeq) chloride intracellular channel 4
  KO
K05024  chloride intracellular channel protein 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    83718 (Clic4)
   04040 Ion channels [BR:rno04040]
    83718 (Clic4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   83718 (Clic4)
  Exosomal proteins of colorectal cancer cells
   83718 (Clic4)
Ion channels [BR:rno04040]
 Chloride channels
  Chloride channel, intracellular (CLIC)
   83718 (Clic4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_2 GST_N_2 GST_N_3 GST_C GST_C_3
Motif
Other DBs
NCBI-GeneID: 83718
NCBI-ProteinID: NP_114006
RGD: 61857
Ensembl: ENSRNOG00000018109
UniProt: Q9Z0W7
Position
5q36
AA seq 253 aa AA seqDB search
MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLK
RKPAHLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMD
IFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPGEIDENSMEDIKSSTRRFLD
GDEMTLADCNLLPKLHIVKVVAKKYRNFDIPKGMTGIWRYLTNAYSRDEFTNTCPSDKEV
EIAYSDVAKRLTK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgtcgatgcccctgaacggactgaaggaggaggacaaagagcccctcatcgag
ctcttcgtcaaggccggcagtgatggtgagagcataggaaactgccccttttcacagagg
ctcttcatgattttgtggctcaaaggagtcgtgttcagtgtcaccaccgttgacctgaaa
aggaagcctgcacatctgcagaacttggctcctgggacccacccaccatttataaccttc
aacagcgaagtcaaaacggatgtaaataagattgaggaatttcttgaagaagtcttgtgc
ccacccaagtacttaaagctctcaccaaaacacccagagtcaaacactgctgggatggac
atctttgccaagttctctgcgtacatcaagaactcaagaccagaggctaatgaagcactg
gagagggggctcttgaaaacgctgcagaagctggatgagtacctgaattctcccctccct
ggcgaaatcgatgagaacagcatggaggacatcaaatcgtccacacgcaggtttctggac
ggcgacgagatgacattagcagactgcaacctgctgcccaagcttcacattgtcaaggtg
gtggccaaaaaataccgcaactttgacattcccaaaggcatgacgggcatctggagatac
ctgacaaacgcctacagtagggatgagttcaccaacacctgtcccagcgacaaggaggtg
gaaatcgcgtacagtgacgtcgccaagagacttaccaagtag

DBGET integrated database retrieval system