KEGG   Rattus norvegicus (rat): 83720Help
Entry
83720             CDS       T01003                                 

Gene name
Fat1, Fat, Fath
Definition
(RefSeq) FAT atypical cadherin 1
  KO
K16506  protocadherin Fat 1/2/3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    83720 (Fat1)
   04515 Cell adhesion molecules [BR:rno04515]
    83720 (Fat1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   83720 (Fat1)
Cell adhesion molecules [BR:rno04515]
 Cadherins
  Cadherin related
   83720 (Fat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Laminin_G_2 Cadherin_3 RET_CLD1 EGF Laminin_G_1 Cadherin_4 EGF_CA DUF2808 hEGF TagA
Motif
Other DBs
NCBI-GeneID: 83720
NCBI-ProteinID: NP_114007
RGD: 621254
Ensembl: ENSRNOG00000030954
UniProt: Q9WU10
Position
16q11
AA seq 4589 aa AA seqDB search
MGRHLALLLLLLFFLQHFGDGDGSQRLEPTPSLQFTHVQYNVTVHENSAAKTYVGHPRKM
GIYILDPSWEIRYKIISGDNENLFKAEEYVLGDFCFLRIRTKGGNTAILNREVRDHYTLV
IKAVEKVTDAEARAKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIG
TNGEFYYSFKDRTDMFAIHPTSGVVVLTGRLDVLETQRYELEILAVDRGMKLYGSSGVSS
LAKLTVHVEQANECAPGITAVTLSPSELDKDPTYAIITVEDCDQGANGEIASLSIVAGDL
LQQFKTVRSFPGSKAFKVKAVGGVDWDSHPYGYNLTVQAKDKGTPPQFSPVKVIHVISPQ
FRAGPVKFEMDVYRAEISEFAPPHTPVVLVKAIPSYSHLRYVFKSTPGKPKFGLNHNTGL
ISILEPIKRQHTSHFELEVTTSDRRASTKVVVKVVGTNSNPPEFTQTSYKASFDENAPVG
TPVMRVSAVDPDEGENGYVTYSIANLNHVPFVIDHFTGAVSTSENLDYELMPRVYTLRIR
ASDWGLPYRREVEVLATITLNNLNDNTPLFEKTNCEGTIPRDLGVGEQITTVSAIDADEL
QLVRYQIEAGNELDLFGLNPSSGVLSLKHSLMDGLGAKVSFHSLRITATDGENFATPLYI
NLTVAASRKPVNLRCEETGVAKMLAEKLLQANKLHHQGDAEDIFFDSHSVNAHAPQFRGS
LPTGIEVKEDLPVGASILFMNATDLDSGFNGKLVYAISGGNDDSCFTVDMETGMLKVLSP
LDREVTDKYTLNITVYDLGIPQRAAWRLLDVTVLDANDNAPEFLQESYFVEVSEDKEINS
EIIQVEATDKDLGPSGHVTYAILTDTEKFAIDRVTGVVKIIQPLDREVQRVHYLKIEARD
QATEEPWLSSTVLLKVSLDDVNDNPPRFIPPSYSVKVREDLPEGTIIMWLEAHDPDVGQS
SQVRYSLLDHGEGHFDVDKLSGAVRIVQQLDFEKKQLYNLTVRAKDKGKPASLSSTGYVE
VEVVDVNENLHAPVFSSFVEKGTVKEDVPMGSSVMTVSAHDEDTGRDGEIRYSIRDGSGV
GVFRIDEETGVIETSDRLDRESTSHYWLTVYATDQGVVPLSSFIEVYIEVEDVNDNAPQT
SEPVYYPEIMENSPKDVSVVQIEAFDPDSSSSDKLTYRITSGNPQGFFSIHPKTGLITTT
SRKLDREQQDEHILEVTVTDNGVPPRSTIARVIVKILDENDNRPQFLQKFYKIRLPEREK
ADGDRSAKREPLYRVIAADKDEGPNAELSYSIEEGNEHGRFSIEPKTGVVSSKKFSAAGE
YDILSIKAIDNGRPQKSSTTRLHIEWISKPKPSLEPISFEESVFSFTVMESDPVAHMIGV
ISVEPPGMPLWFDIIGGNYDSHFDVDKGTGTIIVAKPLDAEQKSSYNLTVEATDGTSTIL
TQVLIKVIDTNDHRPQFSTSKYEVSVPEDTEPETEILQISAVDRDEKNKLIYTLQSSIDP
ASLKKFRLDPATGALYTSEKLDHEAIHQHVLTVMVRDQDVPVKRNFARIIVNVSDMNDHS
PWFTSSSYEGRVYESAAVGSVVLQVTALDRDKGRNAEVLYSIESGNIGNSFTIDPILGSI
KTARELDRSHQVDYDLMVKATDKGEPPMSEMTSVRISVTVADNASPKFTSKEYSAEISEA
IRIGSFVGMVSAHSQSSVMYEVKDGNIGDAFNINPHSGSIVTQRALDFETLPIYTLTVQG
TNMAGLSTNTTVVVHIQDENDNPPAFTRAEYSGFISESASVNSVVLTDKNVPLVIRATDA
DRESNALLVYQIVEPSVHNYFAIDPTTGAIHTVLSLDYEETRVFHFTVQVHDMGTPRLFA
EYAANVTVHVIDINDCPPVFSKSLYEASLLLPTYKGVNVITVNATDADSRAFSQLIYSIT
KGNIGEKFSMDHKTGTIAIQNTTQLRSRYELTVRASDGRFTSVASVRINVKESRESPLKF
TQDAYSAVVKENSTEAKTLAVITAIGNPINEPLFYRILNPDRRFKISHTSGVLSTTGIPF
DREQQETFVVVVEVTKEREPSAVAHVVVKVTVEDQNDNAPVFVNLPYYAVVKVDAEVGHV
IRHVTAIDRDSGRNGDVHYYLKEHHDHFEIGPSGDISLKKQFEHDTLNKEYLVTVVAKDG
GNPAFSAEVLVPITVMNKAMPVFEKAFYSAEIPENVQTHSPVVHVQANSPEGLKVFYSIT
DGDPFSQFTINFNTGVINVIAPLDFESHPAYKLSIRATDSLTGAHAEVFVDIVVEDINDN
PPVFVQQSYSTTLSEASVIGAPILQVRATDSDSEPNRGISYQLIGNHSKSHDHFHIDSHT
GLISLVRALDYEQFQQHKLLVRAVDGGMPPLSSDVVVTVDVTDLNDNPPLFEQQVYEARI
SEHAAHGHFVMCVKACDADRSDLDRLEYSILSGNDHKSFVIDGETGIITLSNPRRHTLKP
FYSLNVSVSDGVFRSSARVNVTVMGGNLHSPVFHQNEYEVELAENAPLHTLVVQVKATDR
DSGIYGHLTYHLVNDFAKDRFYVNDGGQVFTLERLDREAPAEKVISVRLMAKDAGGKVAF
CTVNVILTDDNDNAPQFRSTKYEVNVGSSAAKGTSVVKVFASDADEGSNADVTYAIEADS
ESVEENLEINQLTGLITTKESLIGLENEFFTFFVRAVDNGSPPKESVVPVYVKILPPEVQ
LPRFSEPFYTYSISEDMPIGTEIDLIRVEHSGTVLYTLVKGNTPESNRDEFFVIDRQSGR
LKLEKSLDHETTKWYQFSILARCTLDDYEVVASIDVSIQVKDANDNSPVLESNPYEAFIV
ENLPAGSRVIQVRASDLDSGVNGQVMYSLDQSQDADIIESFAINMETGWITTLKELDHEE
RASYQIKVVASDHGEKVQLSSTAIVDVTVTDVNDSPPRFTAEIYKGTVSEDDPPGGVIAI
LSTTDADSEEINRQVSYFITGGDALGQFAVENMQNDWRVYVKKPLDREQKDSYLLTVTAT
DGTFSSKARVEVKVLDANDNSPVCERTAYSDAIPEDALPGKLVMQVSATDADIRSNAEIT
YTLFGSGAEKFKLNPDTGELRTLALLDREEQAVYHLLVKATDGGGRSCQATIVLTLEDVN
DNTPEFTADPYAITVFENTEPGTPLTRVQATDADAGLNRKISYSLLDSADGQFSINEQSG
ILQLEKHLDRELQAVYTLTLKAADQGLPRKLTATGTVVVSVLDINDNPPVFEYREYGATV
SEDIVIGTEVLQVYAASRDIEANAEITYAIISGNEHGKFSIDSKTGAIFIIENLDYESSH
GYYLTVEATDGGTPSLSDVATVNINITDINDNSPVFSQDSYTTVVSEDAALEQPVITIMA
DDADGPSNSHILYSIIEGNQGSPFTIDPVRGEIKVTKPLDRETISGYTLTVQAADNGNPP
RVNTTTVNIDVSDVNDNAPLFSRDNYSVIIQENKPVGFSVLKLVVTDKDSSHNGPPFSFA
IVSGNDDNMFEVNQHGVLLTAATVKRKVKDHYLLHVKVADNGKPQLSSLTHIDIRVIEES
IHPPAILPLEIFITASGEEYSGGVIGKIHATDQDVYDTLTYSLDPHMDGLFSVSSTGGKL
IAHRKLDIGQYLLNVSVTDGKFTTVADITVHIQQVTQEMLNHTIAIRFANLTPEEFVGDY
WRNFQRALRNILGIRKNDIQIVSLQPSEPHSHLDVLLFVEKSGGTQISTKQLLHKINSSV
TDIEEIIGVRILDVFQKLCAGLDCPWKFCDEKVSVDENIMSTHSTARLSFVTPRHHRTAV
CLCKDGTCPPVHQGCEDNPCPAGSECVADPREEKYSCVCPGGGFAKCPGSSSITFTGSSF
VKYRLMENENRLEMKLTMRLRTYSSHAVVMYARGTDYSILEIHTGRLQYKFDCGSGPGIV
SVQSIQVNDGQWHAVSLEVEGNYAKLVLDEVHTASGTAPGALKTLNLDNYVIFGGHLRQQ
GTKHGRNTQVANGFRGCMDSIYLNGQELPLNNKPRAYAHIEEWVDLAHGCLLTATEDCSS
NPCQNGGVCNPSPTGGYYCKCSALHAGTYCEVSVNPCSSNPCLYGGTCMVDNGGFVCQCR
GLYTGQRCQLSPYCKDEPCKNGGTCFDSLDGAVCQCDSGFRGERCQSDIDECAGNPCRNG
ALCENTHGSYHCNCSQEYRGKHCEDATPNHYVSTPWNIGLAEGIGIIVFIAGIFLLVVVF
VLCRKMISRKKKHQAEPEDKRLGPTTAFLQRPYFDSKPSKNIYSDIPPQVPVRPISYTPS
IPSDSRNNLDRNSFEGSAIPEHPEFSTFNPESMHGHRKAVAVCSVAPNLPPPPPSNSPSD
SDSIQKPSWDFDYDAKVVDLDPCLSKKPLEEKPSQPYSARESLSEVQSLSSFQSESCDDN
GYHWDTSDWMPSVPLPDIQEFPNYEVIDEHTPLYSADPNAIDTDYYPGGYDIESDFPPPP
EDFPAPDELPPLPPEFSDQFESIHPPRDMPAAGSLGSSSRNRQRFNLNQYLPNFYPVDMS
EPQKQGAGENSTCREPYTPYPPGYQRNFEAPTIENMPMSVYTSTASCSDVSACCEVESEV
MMSDYESGDDGHFEEVTIPPLDSQQHTEV
NT seq 13770 nt NT seq  +upstreamnt  +downstreamnt
atggggagacacttggccttgcttctgcttctgctcttcttcctccagcattttggagat
ggtgatggaagccaaagacttgaaccgaccccttccctccagtttacacacgtccagtac
aatgtcactgtgcacgaaaactcggccgcaaagacctatgtcggccaccctagaaaaatg
ggcatctacatcttagacccctcgtgggaaataaggtacaaaatcatctcaggagacaac
gaaaacctattcaaagcggaagagtatgttctcggagacttttgctttctaaggataaga
accaagggagggaatactgccatcctgaaccgagaagtgagagaccattacacactggta
atcaaagcagttgaaaaagtcacagatgccgaggcccgagccaaggtcagggtgcaagtg
ctggatacaaacgacttacggccgttgttctcacccacgtcctacagcgtttctctgccg
gaaaacacagccataaggaccagtatcgcaagagtcagtgccacggatgcggacattgga
accaacggcgaattttactacagctttaaagacagaacggacatgtttgccatccaccca
accagtggtgtggttgttttgactggcaggcttgatgtcctggagacccagcgctatgag
ctggagatcttggctgtggaccggggaatgaagctgtacggtagcagtggggtcagcagt
ctggccaagctgacggttcacgtggagcaggctaacgagtgtgcacccgggataaccgcc
gtgacgttatcaccatctgagctggacaaggacccaacgtacgccattatcactgtggag
gactgcgatcagggtgccaacggggagatagcatctttgagcattgtggctggcgacctc
cttcagcagtttaaaacggtgaggtctttcccagggagtaaagcattcaaagtgaaagcc
gtcgggggcgtcgactgggacagccatccttatggctacaacctgacagtgcaggctaaa
gacaaaggaactcctccgcagttttcccctgtgaaagtcattcacgtcatttctcctcag
ttcagagctggcccggtcaagtttgaaatggatgtttacagagctgagatcagtgagttt
gcccctccacatacacccgtggtcctggtcaaggctattcctagttattcccatttgagg
tacgtttttaaaagcactcctggaaaacccaaattcggtttaaatcacaacacgggtctc
atttccattttagaaccaattaaaaggcagcacacatcccattttgagcttgaggtgaca
acaagtgacagacgagcctccaccaaagtcgtggtcaaagttgtaggtacaaacagcaac
cccccggagtttacacagacctcgtacaaagcatcctttgatgagaatgcacccgtcggt
accccggtcatgagggtgagcgcggttgaccctgacgagggggagaatggctacgtgact
tacagtattgcaaacttaaatcacgtgccatttgtcatcgaccactttacgggtgctgtg
agtacctctgagaatctggactatgaactgatgcctcgagtctacacgctgaggattcgt
gcttccgactggggcttaccgtaccgccgggaagttgaagtccttgccacaattactctg
aataacctgaatgacaacacccccctgtttgagaagacaaactgtgaagggacaattccc
cgagacctgggtgtaggggagcagataaccacggtttctgccattgacgctgatgagctg
cagttggtccggtaccagattgaagctggaaatgagttggatttgtttggcttaaacccc
agctctggtgtgctgtcattgaagcactcgctcatggacggcttgggtgcaaaggtttcc
tttcacagcttgagaatcacagctacagacggagaaaattttgccacaccattatatatc
aacctaacggtggctgccagtcgcaagccagtaaacttgcggtgtgaggagaccggtgtt
gccaaaatgctggcagagaaactcctgcaggcgaataaattacaccatcagggggacgcg
gaggatattttctttgattctcactccgtcaacgcccatgccccacagtttaggggttct
cttccaacaggaattgaggtaaaggaggacctcccagtgggcgccagtatactattcatg
aatgctactgaccttgactctggcttcaatgggaaactggtctatgctatctctggaggg
aatgatgacagttgctttactgttgacatggaaacaggaatgctgaaagtcctctctcca
cttgaccgagaagtaacggacaaatacacactgaacattaccgtgtatgaccttggtata
ccccagagggctgcctggcgccttctggatgtcaccgtcctggatgccaatgacaacgcg
cccgagtttttacaggagagctattttgtcgaagtgagcgaagacaaggagataaacagt
gaaatcatccaggtagaggccaccgataaagacctgggccccagcggacacgtgacatac
gccatcctcacggacacagagaagtttgcgatcgacagggtgaccggtgtggtgaaaatt
atccagcctttggatcgtgaagtgcagcgtgtacattacctgaagatcgaggccagggac
caagccacagaggaaccctggctgtcctccactgtgcttctgaaagtgtcactcgatgat
gttaatgacaacccacctaggttcattccacccagttactccgtgaaggttcgagaagac
ctaccggaaggaaccatcatcatgtggttagaagcccatgaccctgatgtaggtcagtcc
agtcaggtgagatacagcctcctggaccacggagaaggccacttcgatgtggataaactc
agcggggcagtgagaattgtccagcagctggactttgagaagaagcaactgtataatctc
accgtgagggccaaagacaaagggaagccggcgtctctgtcttccactggctacgtggaa
gtggaggtcgtggacgtgaatgagaacttacacgcgccagtgttctccagcttcgtggag
aagggcacagtgaaagaagacgtccctatgggctcatcagtaatgaccgtgtcagctcac
gatgaggacaccgggagagatggagagatccggtattccatcagagatggctctggtgtt
ggtgttttcaggatagatgaagaaacaggtgtcatagagacctcagatcgactggaccga
gagtcgacttcccactactggctcaccgtctacgccacagatcagggtgtggtgcctctg
tcatccttcatagaggtctacatagaggttgaggatgtcaatgacaacgcaccacagaca
tcagagcctgtgtattatcctgaaataatggagaattcacccaaggatgtatctgtggtc
cagattgaggcatttgacccggattccagctccagtgacaagctgacgtacagaattaca
agtggaaatccccaagggttcttctcaatacaccctaaaacaggtctcatcacaaccaca
tcgaggaagctggaccgagagcagcaggatgaacacattctggaagttactgtgacagac
aatggtgtacctcccagatccaccattgccagggtcattgtgaaaatcctggatgagaac
gacaacaggcctcagttccttcagaagttttataaaatcaggctcccggagcgagaaaaa
gctgatggagaccggagcgcgaagcgcgagcctctctaccgagtcatagccgcagataag
gatgaagggcccaatgccgagctctcctacagcatcgaggaagggaacgagcacggccgg
ttttccattgaacccaagacaggagtggtctcatccaaaaagttctctgcggctggagaa
tacgacattctttctattaaggcaattgacaatgggcgcccccagaagtcatcgaccacc
agactccatattgaatggatctccaaacccaagccgtccttggagccgatttcgtttgag
gaatcggttttctcgtttactgtaatggagagtgatccggtggctcacatgatcggcgtg
atctccgttgagcctcctggcatgcctctgtggtttgacatcatcgggggcaactatgac
agtcactttgatgtggacaagggcactggaaccatcattgtggccaagccccttgacgca
gagcagaagtccagctataacctcacagtggaggcgacagacgggacctccactatcctc
acccaggtactcatcaaagtaatagataccaatgaccaccgccctcagttttctacctcg
aaatacgaagtctctgttcccgaagacacagagccagaaacagagattctgcaaatcagc
gccgtagacagggacgagaaaaacaaactgatctacaccctccagagcagcatagatcca
gcaagtctcaagaaattccgcctcgatcctgcaacaggcgctctctacacatctgagaag
ctcgatcacgaagccattcaccagcacgtcctcacagtcatggtccgggatcaggatgtc
cctgtgaaacgcaactttgccagaatcattgtgaatgtcagtgacatgaatgaccactct
ccgtggttcaccagttcgtcctatgaagggcgggtttatgagtcggcagccgtgggctcg
gtcgtgctacaggttacagctctggacagagacaaagggagaaatgctgaagtgctctac
tccatcgagtcaggaaacattggaaattcctttacaatcgaccccatcttgggctctata
aaaactgccagagaattggatcgaagtcaccaagtagactatgatttaatggtaaaagct
acagacaaaggggagccaccaatgagcgaaatgacctccgtgcggatctctgtcaccgtc
gccgacaatgcctctcctaagttcacatccaaggagtactcggctgagattagtgaagcc
atcaggattgggagttttgttggaatggtctctgctcacagtcagtcatcagtgatgtat
gaagtaaaagatggaaatataggcgatgcatttaatatcaatccacattcaggaagcatc
gtcactcagagagccttggattttgagacactgcccatttatacattgacagtacaaggg
accaacatggccggcttgtccaccaatacaacggtggtagtgcacatacaggatgagaat
gacaaccctccagctttcacacgggcggaatattcaggattcattagtgaatcagcctca
gtcaacagcgtggtgctaacggataagaatgttccgctcgtgatccgagccaccgacgct
gatcgggaatccaatgctctgctcgtctatcaaattgtcgagccatctgtgcacaactat
tttgccattgatcccaccaccggtgccatccataccgtactgagtctggactatgaagag
acacgtgtctttcacttcaccgtccaagtgcatgacatggggacgcctcgtctgtttgct
gagtatgcagcaaatgtgaccgtgcatgtgattgacatcaatgactgcccccctgtcttc
tctaagtcactgtacgaagcatccctcctattgccgacgtacaaaggcgtgaacgtcatc
acagtgaatgccacagatgccgactccagggcgttctcccagttaatatactccatcacc
aaaggcaacattggggagaagttctccatggaccacaagactggcaccatagcaattcag
aacacaacccagttacggagccgctatgagctgaccgtccgcgcctccgatggccggttt
acaagcgtggcctccgtgagaatcaacgtgaaggaaagcagagagagtcctctcaagttt
acccaagatgcctactctgcggtggtgaaggagaactccaccgaagccaaaaccttagct
gtcattaccgcgatagggaacccgattaacgagcctttgttttaccgtatcctcaaccca
gaccgcagatttaaaatcagccacacctcaggcgtgttgtcaaccactgggataccattt
gatcgggagcaacaggagacgtttgttgtggtggtagaggtgactaaagaacgggagccg
tcggccgtggcccacgttgtggtgaaggtcaccgtggaagaccagaatgataatgcaccc
gtgtttgtcaaccttccctactatgctgtggtgaaggtggatgctgaggtgggccatgtc
atccgccacgtcactgccattgacagagacagtggcagaaacggtgacgttcactactac
cttaaggagcatcatgaccactttgagattggaccctctggtgacatttctctgaaaaag
caatttgagcacgacaccttgaataaagaataccttgtcacagtggttgcgaaggacggg
gggaacccagctttctccgcagaagttctagttcccatcaccgtcatgaacaaagccatg
cccgtgtttgaaaaggctttctacagtgcagagattcccgagaacgtccagacgcacagc
ccagtggtccacgtccaagccaacagcccagaagggttgaaagtgttctacagtatcaca
gacggggacccttttagtcagtttactatcaacttcaacactggggtgataaacgtcatc
gcaccgctggactttgagtcccacccagcctataagctaagcatacgggccactgactcc
ctgactggcgcccacgctgaagtgtttgttgacatcgtagtagaagacatcaatgacaac
cctcccgtgtttgtgcaacagtcttactcgacaaccctgtctgaagcatctgtcatcgga
gcgcctatccttcaagttagagccaccgactctgactcggaaccaaatagagggatttcc
taccagctgattggaaatcacagcaaaagccacgatcactttcacatagatagtcacact
gggctgatttcactggtgagggctttggattacgaacagttccagcagcacaagctgctc
gtaagggctgttgatggaggaatgccgccactgagcagcgatgtggtcgtcactgtggat
gtcaccgacctcaacgataacccgcctctgtttgaacaacaggtttacgaagctaggatc
agtgagcacgctgcccacgggcattttgtgatgtgcgtaaaggcctgtgatgcagatcgc
tcagacctagacaggctggagtactccattctgtccggcaatgatcacaagagctttgtc
attgacggggagacaggaatcatcacgctctccaacccgcgccgccacaccttgaagccg
ttctatagtctcaacgtttctgtgtctgatggggttttccgaagctcggctcgggtgaat
gtcaccgtgatgggagggaatttgcacagccctgtctttcaccagaatgagtatgaggta
gagctggctgaaaacgcccccttgcacaccctggtggtccaagtgaaggctactgacaga
gattccggtatctacggccacctgacttaccaccttgtaaatgactttgccaaagacagg
ttttacgtgaacgacggagggcaggtcttcactctggagagacttgatcgagaggctcca
gcagagaaagtgatctcagtccgtttaatggctaaggatgctggggggaaggtcgccttc
tgcactgtcaacgtcatcctcacggacgacaatgacaacgcaccacagtttcgctcaacc
aagtacgaggtgaacgtggggtccagcgccgccaaagggacgtcggtcgtcaaggtcttc
gcgagtgatgccgatgaggggtcgaatgctgacgtcacctacgccatcgaggcagattcg
gaaagtgtcgaggagaacttggaaatcaaccaactgaccggcctcattactacaaaggaa
agcttaataggtttagagaatgaattcttcactttcttcgttagagctgtggataacggg
tctccgcccaaagagtctgttgttcctgtctatgttaaaatacttcccccggaagtgcag
cttcctaggttctcagagcccttttatacctattccatttcagaagacatgcctattggc
acagagattgacctcatccgggtagagcatagcgggactgttctctacaccctggtcaaa
ggcaatactcccgagagtaacagggacgagttctttgtgattgaccggcagagtgggaga
ctgaagctggagaagagccttgaccacgagaccactaagtggtatcagttttccatcctg
gccaggtgtactctggatgactacgaggtggtggcttctatagatgtcagtatccaggtg
aaagacgctaatgataacagcccagttttggagtccaatccatacgaggcatttattgtc
gaaaacctgccagcagggagtagggtcatccaggtcagagcatctgacctagactcagga
gtcaacggccaagtcatgtacagtctagatcagtcccaagatgcagacatcatcgagtct
tttgccattaacatggaaacaggctggattacaaccctcaaggagcttgaccatgaagag
agagccagttaccagattaaagtggttgcctcagaccatggtgaaaaggtgcagctgtct
tccaccgccattgtggatgtcaccgtcactgacgtcaacgacagcccgcctcgattcaca
gctgagatttataaagggacagtgagtgaggatgaccccccagggggtgtgatcgccatc
ttgagcaccactgacgccgactctgaagagattaaccgacaagtgtcgtacttcataaca
ggaggggatgcattgggacagtttgctgtggaaaatatgcagaatgactggagggtgtac
gtgaagaaacctctcgacagggaacaaaaggacagttaccttctgaccgtcactgcaaca
gatgggaccttctcttccaaagctagagttgaagtcaaggttctcgatgccaatgataac
agtccagtgtgtgagaggaccgcatattctgatgccattcccgaagacgctcttccgggg
aagctggtcatgcaggtctctgccacagatgcagatatccggtccaacgcggagatcact
tacactttatttggctcaggtgcagaaaagtttaaactgaatccagacacaggtgaactg
agaacattagccctccttgatcgtgaggagcaagcagtttatcatcttctggtcaaggcc
acagacggagggggcagatcctgtcaggcaactattgtgctcacgttagaagatgtaaat
gacaacacccccgagttcaccgcggatccatacgccatcacggtatttgaaaacacagag
cctgggacaccgttgaccagagtgcaggccaccgatgcagacgcagggttgaatcggaag
atttcctactcactgcttgactctgctgacgggcagttctccattaacgagcagtccgga
attcttcagttggaaaagcatttggacagggaactacaggcagtctatactctcactttg
aaagcagcggaccaaggattgccaaggaaattgacagccactggcacggtggttgtgtct
gttttggatataaatgacaacccacctgtgtttgagtaccgtgaatatggtgccaccgtg
tcagaggacattgtcatcgggaccgaagttctccaggtgtacgcagccagtcgggatatc
gaggcgaatgcagaaatcacatacgcaatcataagtgggaacgaacacggaaaattcagc
atcgattctaagacaggggccatatttatcattgagaacctggattatgaaagctcccat
ggctattacctgactgtggaagccactgatggaggcacgccctcgttgagtgacgtggcg
accgtgaacatcaacatcacagatattaacgataacagcccagtgttcagccaggacagc
tacaccacagtggtcagcgaagacgcggccctggagcagcccgtcattacaattatggct
gatgatgctgatggcccttcaaacagccacatcctctactccattatagagggtaaccaa
ggaagtccattcacaatcgaccctgtcagaggagaaatcaaagtaacgaagcccctagac
cgcgaaacgatctcaggttatacgctcacggtgcaggctgccgacaacggcaatccaccc
agagtcaacaccaccacagtgaacatcgatgtctccgatgtcaacgacaatgctcccctc
ttctccagagacaactacagtgtcatcatccaggaaaacaagcccgtgggtttcagcgtc
ctgaagctagtagtgacagacaaggactcgtcccacaacggcccccctttctcctttgct
attgtgagtggaaatgatgacaacatgtttgaggtgaaccagcacggggtcctcctgaca
gcggcaacagtcaagaggaaagtgaaggaccattaccttctgcacgttaaggtggctgac
aatggaaagcctcagctgtcttcgttgacacacattgacatcagggttattgaggagagc
atccaccctcctgccattttgccactggagattttcatcactgcttctggagaggaatac
tcaggcggggtcataggaaagatccatgccacagaccaggatgtgtatgacaccttgacg
tacagtctggatccccacatggatggcctgttctctgtttccagcacggggggtaaactg
attgcacacagaaagctggatataggccagtaccttcttaatgtcagcgtgacagacggg
aagtttacaacggtggctgacatcaccgtgcacatccagcaagtgacccaggagatgctg
aaccacaccatcgctatccgatttgcaaatctcaccccggaagagtttgtcggcgactac
tggcgcaacttccagcgagctttacgcaacatcctgggcatccggaagaacgacatacag
attgtcagcttgcagccctccgaaccccactcccaccttgacgtcttactctttgtagag
aaatcagggggcacccagatctcaacgaaacaacttctgcacaagatcaattcttccgtc
acggacatcgaggaaatcattggcgtgaggatactggatgtgttccagaaactctgtgca
gggctggattgcccgtggaaattctgtgatgagaaggtttctgtggatgaaaacattatg
tcaactcatagcacagccagactgagttttgtgactccccggcaccatagaacagccgtg
tgtctctgcaaagatgggacatgcccgcctgtccaccaagggtgcgaagataacccctgt
cctgcaggatccgaatgtgtcgctgatccccgagaagagaagtacagctgtgtgtgtcct
ggtggcgggttcgccaaatgtccagggagttcatccataacttttaccggcagcagcttt
gtgaaatatcgtctgatggaaaatgaaaaccgactggagatgaagttgaccatgcgcctg
agaacctactcttcccacgcggttgtgatgtacgctcgaggaactgactacagtatcctg
gagattcatactgggagactgcagtacaaatttgactgtggaagtggccctgggatcgtc
tctgttcagagcattcaagtcaacgatgggcagtggcatgcagtgtccctggaagtggag
gggaattatgcaaaattggttctagatgaagtccacactgcctcgggcacagccccagga
gctctgaaaaccctcaacctggataactacgtaatttttggtggccacctccgccagcaa
gggacaaaacatggacgaaacacccaggtggccaatggtttcaggggctgcatggactct
atttatttgaatgggcaggagctacctttgaacaacaaaccaagagcctatgcacacatc
gaagaatgggtggacctagctcatgggtgcttgttaactgccaccgaagactgttccagc
aacccttgtcagaatggaggcgtctgcaatccctcgcccactggaggttattactgcaag
tgcagtgcattgcacgcagggacgtactgtgaggtgagcgtcaacccgtgctcctccaac
ccctgcctctacggaggaacgtgcatggtagacaacggaggttttgtttgccagtgcagg
gggctgtacactggccagagatgtcagcttagtccgtactgcaaagatgaaccctgtaaa
aatggtggaacgtgttttgacagtttggatggtgctgtctgtcagtgtgactcaggcttt
aggggagaaagatgtcagagtgacattgacgagtgtgctgggaacccctgtcggaacggg
gccctttgcgagaacacgcatggctcctatcactgtaactgcagccaggagtacagaggg
aagcactgtgaggatgccactcccaaccactacgtgtccaccccgtggaacatcggactg
gccgaaggaatcggaattattgtgtttatagccgggatattcttactggtggtggtgttt
gtcctctgccgaaagatgatcagtcggaagaagaaacaccaggcggaacctgaagacaag
cgtttggggccaaccacggctttcttacagagaccttactttgattccaagccgagcaag
aacatttactctgacatcccgccccaggtgcccgtgcgtcccatttcctacactccgagc
attcccagtgactctagaaacaatctggaccggaactcgtttgaaggctcggcaatccca
gagcacccagaattcagcacttttaaccccgagtctatgcacggacatcggaaagccgtg
gctgtgtgcagcgtggctccaaacttgcctcccccacccccttccaactctccctcagac
agcgactccattcagaagcccagctgggacttcgactacgacgctaaagtggtggatctt
gacccttgtctttccaagaagcccctggaggaaaaaccctctcagccatacagtgcccgg
gagagcctgtccgaggtgcagtcccttagctccttccagtcagagtcctgtgatgacaat
gggtaccactgggatacatcagactggatgcccagtgttcctctgccagacatacaagag
ttccccaattacgaggttatcgatgagcacacgcccctctactcagctgatccaaatgcc
atcgacactgactattaccctgggggttatgacattgaaagtgactttccacccccacca
gaggacttccctgcacccgatgaactgccaccattgcctccagaattcagcgaccagttc
gagtccatacacccacccagagacatgcccgcagcaggtagcttggggtcttcctccagg
aatcgtcagaggttcaacctgaatcagtacctgcccaatttctaccccgtcgatatgtct
gaacctcagaaacaaggcgctggtgagaacagtacctgtagagaaccctacactccctac
cctccagggtatcaaagaaacttcgaggcgcccaccatagaaaacatgcccatgtctgtg
tacacctctacggcttcctgctccgatgtgtcagcgtgctgcgaagtggagtctgaggtc
atgatgagtgactacgagagcggggacgacggccactttgaagaggtgaccattcccccg
ctagattcccagcagcatacggaagtgtga

DBGET integrated database retrieval system