KEGG   Rattus norvegicus (rat): 83721
Entry
83721             CDS       T01003                                 

Gene name
Dvl1, dvl-1
Definition
(RefSeq) dishevelled segment polarity protein 1
  KO
K02353  segment polarity protein dishevelled
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04150  mTOR signaling pathway
rno04310  Wnt signaling pathway
rno04330  Notch signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04916  Melanogenesis
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    83721 (Dvl1)
   04330 Notch signaling pathway
    83721 (Dvl1)
   04390 Hippo signaling pathway
    83721 (Dvl1)
   04150 mTOR signaling pathway
    83721 (Dvl1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    83721 (Dvl1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    83721 (Dvl1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    83721 (Dvl1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    83721 (Dvl1)
   05226 Gastric cancer
    83721 (Dvl1)
   05217 Basal cell carcinoma
    83721 (Dvl1)
   05224 Breast cancer
    83721 (Dvl1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    83721 (Dvl1)
   05022 Pathways of neurodegeneration - multiple diseases
    83721 (Dvl1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    83721 (Dvl1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    83721 (Dvl1)
SSDB
Motif
Pfam: Dishevelled Dsh_C DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 83721
NCBI-ProteinID: NP_114008
RGD: 620632
Ensembl: ENSRNOG00000019423
UniProt: Q9WVB9
Position
5q36
AA seq 695 aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSF
HPNVASSRDGMDNETGTESMVSHRRERARRRNRDEAARTNGHPRGDRRRELGLPPDSAST
VLSSELESSSFIDSDEEDNTSRLSSSTEQSTSSRLIRKHKCRRRKQRLRQTDRASSFSSI
TDSTMSLNIITVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTIPRADPVRPIDP
AAWLSHTAALTGALPRYGTSPCSSAITRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAIVR
VMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSMLKHGFL
RHTVNKITFSEQCYYVFGDLCSNLASLNLNSGSSGASDQDTLAPLPHPSVPWPLGQGYPY
QYPGPPPCFPPAYQDPGFSYGSGSAGSQQSEGSKSSGSTRSSHRTPGREERRATGAGGSG
SESDHTVPSGSGSTGWWERPVSQLSRGSSPRSQASAVAPGLPPLHPLTKAYAVVGGPPGG
PPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM
NT seq 2088 nt   +upstreamnt  +downstreamnt
atggcggagaccaaaatcatctaccacatggacgaggaggagacgccgtacctggtcaag
ctgcccgtagctcccgagcgcgtcacgctggcagacttcaagaacgtgctcagcaaccgg
ccggtgcacgcctacaaattcttcttcaagtctatggaccaggacttcggggtggtgaag
gaggagatcttcgacgacaatgccaagttgccctgcttcaatggccgtgtggtttcctgg
ctggtcctggctgagggcgctcactcggatgcagggtcccagggcactgacagccacacg
gacctgcccccaccccttgagaggacaggcggcattggggactccaggcccccctccttc
catccaaatgttgccagtagccgagatggaatggacaatgagacaggcacagagtcaatg
gtcagtcaccggcgggagcgagcccgacgtcgaaaccgtgatgaggctgcccggaccaat
gggcacccaagaggggaccggcggcgggagctgggactacctccagacagtgcgtccact
gtactgagcagtgagcttgaatctagcagctttattgactcagatgaggaggacaacacg
agccggctgagcagctctacagagcagagtacctcctctcggctaattcgtaagcacaaa
tgccgtcgtcggaagcagcgcttgaggcagacagaccgggcatcctccttcagcagcatc
accgactctaccatgtccctgaacatcatcactgtcacgctcaacatggagaggcaccac
ttcctgggcatcagcatcgtgggccagagcaacgaccggggtgatggcggcatctacatt
ggatccatcatgaagggcggggctgtggctgctgatggccgcattgagccaggcgacatg
ttgctgcaggtgaatgatgtcaactttgagaacatgagcaacgatgatgccgtgcgggtg
cttcgggagatcgtatcccagacggggcccatcagtctcacagtggccaagtgctgggac
ccaacccctcggagctacttcaccatcccaagggctgacccagtgcgacccatcgacccg
gctgcctggctgtcccacacagcagcactgaccggtgctctgccccgctatggtacgagt
ccctgctccagcgccatcacacgcaccagctcttcctcactaaccagctcagtgcctggc
gccccacagcttgaggaggcaccactgactgtgaagagtgacatgagtgccattgtccgc
gtcatgcagttgccagactcgggactggagatccgggaccgcatgtggcttaagatcacc
attgccaatgctgtcattggggcggatgtggtggactggctgtacacacacgtggagggc
ttcaaggagcgaagggaggcgaggaagtatgccagcagcatgctgaagcatggtttcctg
cggcacacggtgaacaagatcactttctctgagcagtgctactatgtctttggtgacctg
tgcagcaacctcgcatccctgaacctcaacagtggctccagtggagcctcagatcaggac
acactggccccactgccccacccatctgtaccctggcccttgggtcaaggctatccctac
cagtacccaggacccccgccctgcttcccacctgcttaccaggaccctggcttcagctat
ggcagtggcagtgctgggagtcagcagagtgaagggagcaagagcagtgggtccacacgg
agcagccatcgcaccccaggccgagaggagcgccgggcaactggagctgggggtagtggc
agtgaatcagaccacacagtaccaagtgggtctggtagcactggctggtgggagcggcct
gtcagccagcttagccgtggcagtagccctcgaagtcaggcttcagctgttgccccaggg
ctccctccactgcacccccttaccaaggcctatgcagtagtgggtgggccacctggaggg
ccacctgtccgggagctggctgctgttcctccagaacttacaggtagccgccagtccttc
caaaaggccatgggaaacccctgtgagttctttgtggacatcatgtga

DBGET integrated database retrieval system