KEGG   Rattus norvegicus (rat): 83725
Entry
83725             CDS       T01003                                 

Gene name
Wfs1
Definition
(RefSeq) wolframin ER transmembrane glycoprotein
  KO
K14020  wolfamin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    83725 (Wfs1)
SSDB
Motif
Pfam: HTH_16 Cytochrome-c551
Other DBs
NCBI-GeneID: 83725
NCBI-ProteinID: NP_114011
RGD: 68954
Ensembl: ENSRNOG00000005108
Vega: OTTRNOG00000001794
UniProt: Q9JLT5
Position
14q21
AA seq 890 aa
MSSGTPPPSPSGPPPPPAPQPQARARLNATTSLEQDKIEPPRAPRPQPDSSAGRSAGEAT
TPEPRAPHASSREGTDKAGPMKADVEIPFEEILEKAKAGDPKAQTEVGKHYLRLANDADE
ELNSCSAVAWLILAAKQGRREAVKLLRRCLADRKGITSENEAEVKQLSSETDLERAVRKA
ALVMYWKLNPKKKKQVAVSELLENVGQVNEQDGGAQPGPVPKSLQKQRRMLERLVSSESK
NYIALDDFVELTKKYAKGIIPNNLFLQDEDEDEDELSGKSPEDLPLRQKVVKYPLHAIME
IKEYLIDVASKAGMHWLSTIVPTHHINALIFFFIISNLTIDFFAFFIPLVVFYLSFVSMV
ICTLKVFQDSKAWENFRTLTDLLLRFEPNLDVEQAEVNFGWNHLEPYIHFLLSVVFVIFS
FPLASKDCIPCSELAVVSAFFTVTSYMSLSSSAEPYTRRALVTEVAAGLLSLLPTMPVDW
PFLKALGQTFFTVPIGHFIILNVSLPCLLYVYLFYLFFRMAQLRNFKGTYCYLVPYLVCF
MWCELSVVILLQSTGLGLVRASIGYFLFLFALPILVAGLALMGTVQFARWFLSLDLTKIM
VTTVICSVPLLFRWWTKANFSVVGMVKSLTRSSIVKLILVWLTAILLFCWFYVYRSEGMK
VYNSTLTWQQYGFLCGPRAWKETNMARTQILCSHLEGHRVTWTGRFKYVRVTEIDNSAES
AINMLPFFLGDWMRCLYGEAYPSCSSGNTSTAEEELCRLKQLAKHPCHIKKFDRYKFEIT
VGMPFGTNGNRGHEEDDITKDIVLRASSEFKDVLLNLRQGSLIEFSTILEGRLGSKWPVF
ELKAISCLNCMTQLSPARRHVKIEQDWRSTVHGALKFAFDFFFFPFLSAA
NT seq 2673 nt   +upstreamnt  +downstreamnt
atgagctcaggcaccccacctccgagcccctctggcccacctcctccacccgcaccacag
ccccaggcccgggcccggctcaatgccaccacctcactggagcaggacaagattgaaccg
cctcgtgctcctagacctcagcctgactccagtgctggacgaagtgctggggaagcaacc
acgccggagcctcgggcccctcacgccagcagccgagaagggacagataaagctggtccc
atgaaggcagatgtggagatcccctttgaagaaatcctggagaaggccaaggctggagac
cccaaagcacagacagaggtgggcaaacactacctgcgacttgccaatgatgcagatgaa
gagctcaacagctgctcggctgtggcctggctaatcctggcggccaagcagggcaggcgg
gaggccgtgaagctgctgaggcggtgcctagctgaccggaaaggcatcacttctgagaat
gaggccgaggtgaagcagctatcctctgagaccgacctggaaagggcagtgcgcaaggct
gccctggtcatgtactggaaactcaaccccaagaaaaagaagcaggtggctgtgtctgag
ctgctggagaatgtcgggcaggtcaacgaacaggatggaggggcgcagccaggccccgtc
cccaagtccctgcagaagcagaggcgcatgctggagcgtctagtgagcagtgaatccaag
aactacattgctctggacgattttgtggagctcaccaagaagtatgccaagggcatcatc
cccaacaacctgttcctgcaggatgaggatgaagatgaagacgagctgtcagggaagagc
cccgaggacctgccactacgccagaaggtggtgaagtaccccttacacgccatcatggag
atcaaagagtacctgattgacgtggcctccaaggcaggcatgcactggctctccaccatc
gtgcccacccatcacatcaacgccctcatcttcttcttcatcatcagcaacctaaccatc
gacttcttcgccttcttcatccccctggtggtcttctacctgtccttcgtgtccatggtc
atctgcaccctcaaagtgttccaggacagcaaggcctgggagaacttccgcactctcacc
gacctgctgctgcgcttcgagcccaacctagatgtggagcaggcggaagtgaacttcggc
tggaaccacctggagccttacatccacttcctgctgtcagtcgtcttcgtgatcttctcc
ttcccgctggccagcaaggactgcatcccgtgctccgagctcgctgtcgtctccgccttc
ttcacggtgacgagctacatgagtctgagcagctccgccgagccctacaccaggcgggcc
ctggtcactgaggtggctgctgggctgctgtcccttctgcccaccatgcccgtggactgg
cccttcctgaaagcactcggccagacgttcttcaccgtgcccatcggccacttcatcatc
ctcaacgtcagcctcccctgcctgctctatgtctatctcttttacctcttcttccgcatg
gcccagctgaggaacttcaagggcacctactgctacctggtgccctacctggtgtgcttc
atgtggtgtgaactgtccgtggtcatcctgctccagtccaccggcctgggcttggtccgt
gcctccatcggctacttcctcttcctctttgccctccccatcctggtggctggccttgcc
ctcatgggcaccgtgcagtttgcccgatggttcctgtcactggacctcaccaagatcatg
gtcaccacagtgatctgcagcgtgcccctgcttttccgctggtggaccaaggccaacttt
tcggtggtgggaatggtcaagtccctgactcggagctccatagtgaagctcattctggtg
tggctcacggccatcctgctcttttgctggttctacgtgtaccggtcggaaggcatgaag
gtctacaattccacactcacctggcagcaatatggcttcctgtgtgggccacgggcctgg
aaggagactaacatggcccggacccagatcctgtgcagccacctggagggccacagggtc
acgtggacaggccgcttcaagtatgtccgagtgaccgagatcgacaacagcgccgagtcg
gccatcaacatgctcccgttcttcctgggtgactggatgcgctgcctgtacggtgaggcc
tacccatcctgtagctctggtaacacgtccacggctgaggaggagctctgccgtctcaag
cagctggccaagcacccctgccacatcaagaagtttgaccgctacaagtttgagatcaca
gtgggcatgcccttcggcaccaacggcaaccgcggccacgaagaagacgacatcaccaag
gacatcgtcctgcgagccagcagcgagttcaaggacgtgctgctgaacctgcgtcagggc
agcctcatagagttcagcaccatcctcgagggccgcctgggtagcaagtggcccgtcttc
gagctcaaggccatcagctgcctcaattgcatgacacagctgtcccctgcccggaggcac
gtaaagatcgaacaggactggcgtagcacggtgcacggtgccctcaagttcgccttcgac
ttcttcttcttcccattcctgtctgccgcctga

DBGET integrated database retrieval system