KEGG   Rattus norvegicus (rat): 83730
Entry
83730             CDS       T01003                                 

Gene name
Vamp8
Definition
(RefSeq) vesicle-associated membrane protein 8
  KO
K08512  vesicle-associated membrane protein 8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04130  SNARE interactions in vesicular transport
rno04140  Autophagy - animal
rno04611  Platelet activation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    83730 (Vamp8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    83730 (Vamp8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    83730 (Vamp8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    83730 (Vamp8)
Membrane trafficking [BR:rno04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    83730 (Vamp8)
SSDB
Motif
Pfam: Synaptobrevin RIFIN Ferlin_C Prominin MCU Baculo_F DUF3671 EVI2A Orf78 Presenilin Sec20 DUF5345 YukC DUF2721 ODV-E18 DUF2207 PRIMA1 DUF3619 Pox_EPC_I2-L1
Other DBs
NCBI-GeneID: 83730
NCBI-ProteinID: NP_114015
RGD: 620421
Ensembl: ENSRNOG00000012748
UniProt: Q9WUF4
Structure
PDB: 
1GL2

Position
4q31
AA seq 100 aa
MEASGSAGNDRVRNLQSEVEGVKNIMTQNVERILARGENLDHLRNKTEDLEATSEHFKTT
SQKVARKFWWKNVKMIVIICVIVLIILILIILFATGTIPT
NT seq 303 nt   +upstreamnt  +downstreamnt
atggaggccagtgggagtgccggaaatgaccgagtcaggaacctgcagagtgaggtggag
ggagtcaagaatattatgacccagaatgtggagcggatcttggcccgaggggagaacctg
gaccatctccgaaacaagacagaggacttggaagccacgtctgaacacttcaagacgacg
tcccagaaggtggcccggaagttctggtggaagaatgtgaagatgattgtcatcatctgt
gtgattgtccttatcattctcatcctcatcatactctttgctacgggcaccatccccact
taa

DBGET integrated database retrieval system