KEGG   Rattus norvegicus (rat): 83781Help
Entry
83781             CDS       T01003                                 

Gene name
Lgals3, AGE-R3, CBP30, L-34, gal-3
Definition
(RefSeq) galectin 3
  KO
K06831  galectin-3
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    83781 (Lgals3)
   04091 Lectins [BR:rno04091]
    83781 (Lgals3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   83781 (Lgals3)
Lectins [BR:rno04091]
 S-type lectins (Galectins)
  83781 (Lgals3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gal-bind_lectin
Motif
Other DBs
NCBI-GeneID: 83781
NCBI-ProteinID: NP_114020
RGD: 69356
Ensembl: ENSRNOG00000010645
UniProt: P08699
Position
15p14
AA seq 262 aa AA seqDB search
MADGFSLNDALAGSGNPNPRGWPGAWGNQPGAGGYPGASYPGAYPGQAPPGGYPGQAPPS
AYPGPTGPSAYPGPTAPGAYPGPTAPGAFPGQPGGPGAYPSAPGAYPSAPGAYPATGPFG
APTGPLTVPYDMPLPGGVMPRMLITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNENNR
RVIVCNTKQDNNWGREERQSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNL
REISQLGIIGDITLTSASHAMI
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcagacggcttctcacttaatgatgccttagctggctctggaaacccaaaccctcga
ggatggcctggtgcatgggggaaccagcctggggcaggaggctacccaggggcctcctat
cctggggcctacccaggacaggctcctccagggggttatcctggacaggctcctcctagt
gcctatccgggcccaactggccctagtgcttatcctggcccaactgcccctggagcttat
cctggcccaactgcccccggagccttcccagggcaacctgggggacctggagcctacccc
agtgctcctggggcctaccccagtgctcctggggcctatcctgctactggcccctttggt
gccccgactggaccactgacagtgccctacgatatgcccttgcctggaggagtcatgcct
cgcatgctgatcacaatcataggcacagtgaagcccaacgcaaacagtatcactctgaat
ttcaagaaagggaacgacatcgccttccactttaacccccgcttcaatgagaacaacaga
agagtcatcgtgtgcaacacgaagcaggacaataactggggaagggaagaaagacagtca
gctttcccctttgagagcggcaaaccattcaaaatacaggtcctggttgaagccgaccac
ttcaaggttgcggtcaatgatgttcatctgttgcagtataaccatcggatgaagaacctc
agggaaatcagccaactggggatcattggtgacataaccctcaccagcgcttcccacgcc
atgatctaa

DBGET integrated database retrieval system