KEGG   Rattus norvegicus (rat): 83782Help
Entry
83782             CDS       T01003                                 

Gene name
Nme2, NDKB, nm23-2, p18-12d
Definition
(RefSeq) NME/NM23 nucleoside diphosphate kinase 2
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
Module
rno_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
rno_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
rno_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    83782 (Nme2)
   00240 Pyrimidine metabolism
    83782 (Nme2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    83782 (Nme2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    83782 (Nme2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     83782 (Nme2)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    83782 (Nme2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-GeneID: 83782
NCBI-ProteinID: NP_114021
RGD: 619877
Ensembl: ENSRNOG00000002671
UniProt: P19804
Position
10q26
AA seq 152 aa AA seqDB search
MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPF
FPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS
DSVESAEKEIGLWFKPEELIDYKSCAHDWVYE
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggccaacctcgagcgtaccttcattgccatcaagccagatggcgtgcagcgcggcctg
gtgggcgagatcatcaagcgattcgagcagaaggggttccgcctggtggccatgaagttc
cttcgggcttctgaggaacacctgaagcagcactatattgacctgaaagaccgtcctttc
ttcccggggctggtgaagtacatgaactcagggcctgtggtggccatggtctgggagggg
ctcaatgtggtgaaaacaggccgagtgatgctgggggagaccaatccagctgattcgaag
ccaggcaccattcgtggggatttctgcattcaagttggcaggaacatcattcacggcagt
gattcagtggagagtgccgagaaagagatcggtctatggtttaagcccgaagaactgatt
gactataagtcttgtgcccatgactgggtgtatgagtag

DBGET integrated database retrieval system