KEGG   Rattus norvegicus (rat): 83785
Entry
83785             CDS       T01003                                 

Gene name
Vegfa
Definition
(RefSeq) vascular endothelial growth factor A isoform 6 precursor
  KO
K05448  vascular endothelial growth factor A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04066  HIF-1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04370  VEGF signaling pathway
rno04510  Focal adhesion
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05219  Bladder cancer
rno05323  Rheumatoid arthritis
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    83785 (Vegfa)
   04014 Ras signaling pathway
    83785 (Vegfa)
   04015 Rap1 signaling pathway
    83785 (Vegfa)
   04370 VEGF signaling pathway
    83785 (Vegfa)
   04066 HIF-1 signaling pathway
    83785 (Vegfa)
   04020 Calcium signaling pathway
    83785 (Vegfa)
   04151 PI3K-Akt signaling pathway
    83785 (Vegfa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    83785 (Vegfa)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    83785 (Vegfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    83785 (Vegfa)
   05206 MicroRNAs in cancer
    83785 (Vegfa)
   05205 Proteoglycans in cancer
    83785 (Vegfa)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    83785 (Vegfa)
   05211 Renal cell carcinoma
    83785 (Vegfa)
   05219 Bladder cancer
    83785 (Vegfa)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    83785 (Vegfa)
   05167 Kaposi sarcoma-associated herpesvirus infection
    83785 (Vegfa)
   05165 Human papillomavirus infection
    83785 (Vegfa)
  09163 Immune disease
   05323 Rheumatoid arthritis
    83785 (Vegfa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    83785 (Vegfa)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    83785 (Vegfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    83785 (Vegfa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    83785 (Vegfa)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    83785 (Vegfa)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   83785 (Vegfa)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   83785 (Vegfa)
SSDB
Motif
Pfam: VEGF_C PDGF Cnd1_N
Other DBs
NCBI-GeneID: 83785
NCBI-ProteinID: NP_001274036
RGD: 619991
Ensembl: ENSRNOG00000019598
UniProt: P16612 B5DEK7
Position
9
AA seq 214 aa
MNFLLSWVHWTLALLLYLHHAKWSQAAPTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDI
FQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMS
FLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQD
PQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaactttctgctctcttgggtgcactggaccctggctttactgctgtacctccaccat
gccaagtggtcccaggctgcacccacgacagaaggggagcagaaagcccatgaagtggtg
aagttcatggacgtctaccagcgcagctattgccgtccaattgagaccctggtggacatc
ttccaggagtaccccgatgagatagagtatatcttcaagccgtcctgtgtgcccctaatg
cggtgtgcgggctgctgcaatgatgaagccctggagtgcgtgcccacgtcggagagcaac
gtcactatgcagatcatgcggatcaaacctcaccaaagccagcacataggagagatgagc
ttcctgcagcatagcagatgtgaatgcagaccaaagaaagatagaacaaagccagaaaaa
aaatcagttcgaggaaagggaaagggtcaaaaacgaaagcgcaagaaatcccggtttaaa
tcctggagcgttcactgtgagccttgttcagagcggagaaagcatttgtttgtccaagat
ccgcagacgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagctt
gagttaaacgaacgtacttgcagatgtgacaagccaaggcggtga

DBGET integrated database retrieval system