KEGG   Rattus norvegicus (rat): 83788
Entry
83788             CDS       T01003                                 

Gene name
Sept9, Eseptin, Msf, Slpa
Definition
(RefSeq) septin 9
  KO
K16938  septin 3/9/12
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    83788 (Sept9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    83788 (Sept9)
   04147 Exosome [BR:rno04147]
    83788 (Sept9)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 1
     83788 (Sept9)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   83788 (Sept9)
SSDB
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 Roc Ras GTP_EFTU Dynamin_N FtsK_SpoIIIE AAA_16 AAA_22 NB-ARC ABC_tran PduV-EutP G-alpha IIGP AAA_24 AAA_29 tRNA_synthFbeta AAA_7 AAA_14 VirE Sigma54_activat HTH_12 FeoB_N
Other DBs
NCBI-GeneID: 83788
NCBI-ProteinID: NP_789826
RGD: 708523
UniProt: Q9QZR6
Position
10q32.2
AA seq 565 aa
MERDRITALKRSFEVEEIEPPNSTPPRRVQTPLLRATVASSSQKFQDLGVKNSEPAARLV
DTLSQRSPKPSLRRVDLAGAKAPEPMSRRTELSIDISSKQVESTASTPGPSRFGLKRAEV
LGHKTPEPVPRRTEITIVKPQESGLRRVETPASKAPEGSAMPVTDAAPKRVEIQVPKPAE
APNCPLPPQTLENSEAPMSQLQSRLEPRPPVTEVPYRNQEDSEVAPSCVGDMADNPRDAM
LKQAPVSRNEKAPVDFGYVGIDSILEQMRRKAMKQGFEFNIMVVGQSGLGKSTLINTLFK
SKISRKSVQPISEERIPKTIEIKSITHDIEEKGVRMKLTVIDTPGFGDHINNENCWQPIM
KFINDQYEKYLQEEVNINRKKRIPDTRVHCCLYFIPATGHSLRPLDIEFMKRLSKVVNIV
PVIAKADTLTLEERVYFKQRITSDLLSNGIDVYPQKEFDEDAEDRLVNEKFREMIPFAVV
GSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFAYLRDLLIRTHMQNIKDITSNIHFEAY
RVKRLNEGNSAMANGIEKEPETQEM
NT seq 1698 nt   +upstreamnt  +downstreamnt
atggagagagatcgcatcacagccttaaagagatcgtttgaagtcgaggagattgagccg
ccgaactccacaccaccccggagggtccagacccctctgctccgagccacggtggccagc
tccagccagaaattccaggacctgggggtgaagaactcagagcctgctgctcgccttgta
gacaccctgagccagcgctcccccaagccttccctgcggagggtggacctggcaggggcc
aaggcgcctgagcccatgtctcgccgcaccgagctctccattgatatctcctccaagcag
gtggagagcacagcctcaacccccgggccctcacggttcgggcttaagagggccgaagtc
ctgggccataagacaccagagcctgtcccccggaggacggaaatcaccattgtcaagcct
caagagtcagggctccgcagggtagagacccctgcctccaaggctcccgagggctctgcc
atgcctgtcaccgatgcagcccccaagagggtagagatccaggtgcccaagccagcggag
gcacccaactgcccgctcccaccccagaccctggagaactccgaggccccgatgtctcag
ctgcagagcaggctggagcccaggccccctgtgactgaggtcccatatcggaaccaggaa
gactccgaggtggctcccagctgtgttggcgacatggctgacaaccctagagatgccatg
ctcaagcaagcgcccgtgtcgaggaatgagaaggcccccgtggactttggctatgtgggg
atcgactccatcctggagcagatgcgcaggaaggctatgaaacagggcttcgagttcaac
atcatggtggttgggcagagtggcctcgggaagtccaccttaatcaacaccctcttcaag
tccaaaatcagccggaagtcggtgcaacccatctcggaggagcgtatccccaagacgatt
gaaatcaagtccatcactcacgatattgaagagaagggggtccgaatgaagttgacagtg
attgacactccaggcttcggggaccacatcaacaatgagaactgctggcagcctatcatg
aagtttatcaatgaccagtatgagaagtacctccaggaggaagtcaatatcaaccggaag
aaacgcatccctgacacccgcgtccactgctgcctctacttcatcccagccaccggccac
tcactcaggcccctggacattgagttcatgaagcgcctaagcaaggtggtgaacatagtc
cccgtcattgccaaggctgacacgctgaccctggaggagagggtctacttcaaacagcgg
atcacctcagacctgctgtccaacggtattgacgtgtacccccagaaggagtttgatgag
gacgcagaggaccgactggtgaacgagaagtttcgggagatgatcccatttgccgtggtg
ggcagcgaccatgagtatcaagtcaatggcaagaggattctgggaaggaagaccaagtgg
ggcaccattgaagttgagaataccactcactgtgaatttgcctacctgcgggatctcctt
atcaggacgcacatgcagaacatcaaagacatcaccagcaacatccacttcgaagcctac
cgtgtgaaacgcctcaacgagggcaacagtgccatggccaacgggatcgagaaggagccg
gaaacccaggagatgtag

DBGET integrated database retrieval system