KEGG   Rattus norvegicus (rat): 83800Help
Entry
83800             CDS       T01003                                 

Gene name
Clta, LCA1, LCA2, LCA3
Definition
(RefSeq) clathrin, light chain A
  KO
K04644  clathrin light chain A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04144  Endocytosis
rno04721  Synaptic vesicle cycle
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno05016  Huntington disease
rno05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    83800 (Clta)
   04142 Lysosome
    83800 (Clta)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    83800 (Clta)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    83800 (Clta)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    83800 (Clta)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    83800 (Clta)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    83800 (Clta)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    83800 (Clta)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    83800 (Clta)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   83800 (Clta)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin_lg_ch CENP-Q ORC3_N
Motif
Other DBs
NCBI-GeneID: 83800
NCBI-ProteinID: NP_114180
RGD: 70919
Ensembl: ENSRNOG00000014635
UniProt: P08081
Position
5q22
AA seq 248 aa AA seqDB search
MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP
GPQAHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISEVDRLQSEPESIRKWREEQTER
LEALDANSRKQEAEWKEKAVKELEEWYARQDEQLQKTKASNRVADEAFYKQPFADVIGYV
TNINHPCYSLEQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLIS
LKQAPLVH
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctgagttggatccatttggcgctcccgccggtgcgcccggtggccccgcgctcggg
aacggggtggcgggcgccggcgaggaagacccggccgcggccttcttggcgcagcaggag
agtgagattgcgggcatagagaacgacgaggccttcgccatcctagacggcggcgccccc
gggccgcaggcacacggcgagccgccggggggtcctgatgcggttgatggagtgatgaat
ggcgaatactaccaggagagcaatggtccaacagacagttacgcagccatttcagaagtg
gatcggttgcagtcagagcctgaaagtatccgtaagtggagagaagagcagacagagcgc
ctggaagccctcgatgccaattctcggaagcaggaagcagagtggaaagaaaaggcagtg
aaggagctggaagagtggtacgcaaggcaggatgagcagctacagaagacaaaagccagc
aacagggtggcagatgaagctttctacaaacaacccttcgctgacgtgattggttatgtc
acaaacataaaccatccttgctacagcctagaacaggcagcagaagaagcctttgtaaac
gacattgacgagtcatccccaggcactgagtgggagcgggtggcccgcctgtgtgacttt
aaccccaagtccagcaaacaggccaaagatgtctctcgcatgcgctcagtcctcatctcc
ctgaagcaggcgcccctggtgcattga

DBGET integrated database retrieval system