KEGG   Rattus norvegicus (rat): 83817Help
Entry
83817             CDS       T01003                                 

Gene name
Ache
Definition
(RefSeq) acetylcholinesterase
  KO
K01049  acetylcholinesterase [EC:3.1.1.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    83817 (Ache)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    83817 (Ache)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    83817 (Ache)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     83817 (Ache)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Enzymes
  83817 (Ache)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase AChE_tetra Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 83817
NCBI-ProteinID: NP_742006
RGD: 69313
UniProt: P37136
Position
12q12
AA seq 614 aa AA seqDB search
MRPPWYPLHTPSLASPLLFLLLSLLGGGARAEGREDPQLLVRVRGGQLRGIRLKAPGGPV
SAFLGIPFAEPPVGSRRFMPPEPKRPWSGILDATTFQNVCYQYVDTLYPGFEGTEMWNPN
RELSEDCLYLNVWTPYPRPTSPTPVLIWIYGGGFYSGASSLDVYDGRFLAQVEGTVLVSM
NYRVGTFGFLALPGSREAPGNVGLLDQRLALQWVQENIAAFGGDPMSVTLFGESAGAASV
GMHILSLPSRSLFHRAVLQSGTPNGPWATVSAGEARRRATLLARLVGCPPGGAGGNDTEL
ISCLRTRPAQDLVDHEWHVLPQESIFRFSFVPVVDGDFLSDTPDALINTGDFQDLQVLVG
VVKDEGSYFLVYGVPGFSKDNESLISRAQFLAGVRIGVPQASDLAAEAVVLHYTDWLHPE
DPAHLRDAMSAVVGDHNVVCPVAQLAGRLAAQGARVYAYIFEHRASTLTWPLWMGVPHGY
EIEFIFGLPLDPSLNYTVEERIFAQRLMQYWTNFARTGDPNDPRDSKSPRWPPYTTAAQQ
YVSLNLKPLEVRRGLRAQTCAFWNRFLPKLLSATDTLDEAERQWKAEFHRWSSYMVHWKN
QFDHYSKQERCSDL
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaggcctccctggtatcccctgcatacaccctccctggcttctccactcctcttcctc
ctcctctccctcctgggaggaggggcaagggctgagggccgggaagaccctcagctgctg
gtgagggttcgagggggccagctgaggggcatccgcctgaaggcccctggaggcccagtc
tcagcttttctgggcatcccctttgcagagccacctgtgggctcacgtagatttatgcca
ccagagcccaagcgcccctggtcaggaatattggatgctaccaccttccaaaatgtctgc
taccaatacgtggacaccctgtaccctgggtttgagggtaccgagatgtggaaccccaat
cgagagctgagtgaagactgcctttatcttaatgtgtggacaccataccccaggcctact
tctcccacacctgtcctcatctggatctatgggggtggtttctacagtggagcatcctcc
ttggacgtgtatgacggccgtttcctggcccaggttgagggaaccgtgttggtatctatg
aactaccgagtgggaacctttggcttcttggctctaccaggaagcagagaagcccctggc
aatgtaggcctgctggatcaacggcttgccttgcaatgggtacaagaaaatatcgcagcc
tttgggggagacccaatgtcagtgactctgtttggggagagtgcaggtgcagcctcagtg
ggcatgcacattctgtccctgcccagcaggagcctcttccacagggctgtcctgcagagt
ggcacacccaatgggccctgggccactgtgagtgcgggagaggccaggcgcagggccaca
ctgctggcccgccttgtgggctgtcccccaggtggcgctggtggcaatgacaccgagctg
atatcctgcttgaggacaaggcccgctcaggacctggtggaccacgagtggcatgtgctg
cctcaagaaagtatcttccggttttccttcgtgcctgtggtggacggggatttcctcagt
gacacgccggacgctctcatcaatactggagattttcaagacctgcaggtgctggtgggt
gtggtgaaggacgagggctcctactttctggtttacggggtcccaggcttcagcaaagac
aatgaatctctcatcagccgggcccagttcctggctggggtgcggatcggtgtaccccaa
gcgagtgacctggcggccgaggctgtggtcctgcattatacagactggctgcaccctgag
gaccctgcccacctgagagatgccatgagtgcggtggtaggcgaccacaacgttgtgtgc
cctgtggcccagctggctgggcgactggctgcccaaggggctcgggtctatgcctacatc
tttgaacaccgtgcctccacattgacttggcccctctggatgggggtgccccatggctat
gaaatcgagttcatctttgggctccccctggatccctcactgaactacaccgtggaggag
agaatctttgctcagcgacttatgcaatactggaccaattttgcccgcacaggggacccc
aatgaccctcgagactctaagtctccacggtggccaccgtacaccactgccgcgcagcaa
tacgtgagcctgaacctgaagcctttggaggtgcggcggggactgcgcgcccagacctgc
gccttctggaatcgttttctccccaaattgctcagcgccacagacacgctggacgaggcg
gagcgccagtggaaggccgagttccaccgctggagctcctacatggtgcactggaagaac
cagttcgaccactatagcaagcaggaacgctgctcagacctgtga

DBGET integrated database retrieval system