KEGG   Rattus norvegicus (rat): 83820
Entry
83820             CDS       T01003                                 

Gene name
Sycp2
Definition
(RefSeq) synaptonemal complex protein 2
  KO
K19529  synaptonemal complex protein 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    83820 (Sycp2)
   03400 DNA repair and recombination proteins [BR:rno03400]
    83820 (Sycp2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Meiosis-specific sister chromatid cohesion proteins
   Synaptonemal complex
    83820 (Sycp2)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     83820 (Sycp2)
SSDB
Motif
Pfam: SYCP2_ARLD SYCP2_SLD
Other DBs
NCBI-GeneID: 83820
NCBI-ProteinID: NP_570091
RGD: 69429
Ensembl: ENSRNOG00000061690
UniProt: O70608
Position
3q43
AA seq 1505 aa
MPVRPDPQQLEKCIDDALRKNDFKPLVTLLQIDICEDVKIKCSKQFLRKLDDLICRELHK
KDIQTISNILISIGRCSKNIFILGQTGLQTMIKQGLVQKMVSWFENSKEIILSQRQSKDE
AVMNMIEDLFDLLMVVYDVNDEGKNQVLESFIPHICALVIDSRVNFCIQQEALKKMNLML
DRIPQDANKILCNQEILTLMSNMGERILDVGDYELQVGIVEALCRMTTEKRRQELAYEWF
SMDFIANAFKKIKDCEFETDCRIFLNLVNGMLGDRRRVFTFPCLSAFLGKYELQIPSDEK
LEEFWIDFNLGSHTLSFYIAGDDDDHQWEAVTVPEEKVDMYNIEVRESKKLLTLTLKNIV
KISKKEGKELLLYFDAALEITNVTKKLFGGNKYKEFTRKQDISVAKTSIHVLFDASGSQI
LVPESQPSPVKENLIHLKEKSNLQKKLTNPLEPDNSSSQRDRKNSQDEITTPSRKKMSEA
SMIVPDTDRYTVRSPILLINTSTPRRSRAPLQAIHSAEKAVSKTSESGVDYAVSLKSRQS
DGRNRGNNRANHNKTATVQNKGHEHHESPDQTFNEIEETLSDAYAVEKVDKPVLPGVLDI
SKNKAHSRWACWTPVTTIKLCNNQRSCALPGDTFTQDTGVNKKCTKQKSVSDDDSEETQR
VKYSKDVIKCNKSEEAEVCERNIQEQNHPKYSQKKNTANAKKNDWHIESETTYKSVLLNK
TTEESLIYKKTCVLSKDVNTTICDKSPSRKSMRSHTKSRKELMSEVTSCELDEIPVRENS
KGKRFTGTAESLINLINKRYNSSDDMISTRKLKEPRDGSGFSKKPELQFNKVQRKSYRKL
KTVVNVTSECPLNDVYNFSLNGADEPVIKLGIQEFQATTREASMDNSIKLVDVRNRDERD
LSLKTKDERILSHERKTLFSDTETECGWDDSKTDISWLRKPKSKRLMDYSRNKNTKKCKS
IKSRSSTEKGQPRSTVVLSKNIAKNDYEVIVDGRTRLPRRATKTKKNYKDLSTSGSESES
EKEISYLFKDKLPTKEETVHSSAQTKKLPKKQQKVFNTEALKGQPSEEQKNSSTLRNGRE
DSLYLSSASVSGSSSSVEVMRCTEKITERDFTQDYDYITKSLSPYPKAASPEFLNRSNRV
VGHGKSPRISETSAVCVRKSCSPASGLPFSPRHTTKNNSVMNIKNTNSVINNQRTQHCNS
YSDVSSNSSEKLYMEPESPDSCENHVQSKREENHAASPFSLSSEKIEKIWFDMPNDNTHV
SGPSQRGSKRRMYLEEDELSNPSEAEVQEAEEREHLVSKKLCQREHFDQHTSETSLSTPE
FSVPKDWQQELQGAGMFYDNINSDYKRKTDTQHKIMDDFTTKTLKLTQQHLLAMACQARG
HRDENIDKFQVTLLDELEKVEKDSQTLRDLEKEFVDIEEKIVHKMRAFHQSERERFRALK
TSLDKSLLVYNSVYEENVLTSEMCLMKANMKMLQDKLLKEMHEEELLNIRRGLESLFKDH
EGNNA
NT seq 4518 nt   +upstreamnt  +downstreamnt
atgccagtgagaccagacccccaacagttagaaaagtgtattgatgatgctttgagaaaa
aacgacttcaagcctttggtgacacttttacaaattgatatttgtgaagatgtgaagatt
aaatgcagcaaacaattcctccgcaagttggatgacttaatatgcagggaacttcataaa
aaggatatccaaactatttcaaacatcttgatatctattggaagatgtagcaagaatatc
tttatattgggacaaactggacttcaaaccatgataaaacaaggattagtccaaaagatg
gtttcctggtttgaaaattccaaggagattattctgagtcagcgacaatcaaaagatgaa
gctgttatgaatatgatagaagacttatttgatcttttgatggtcgtatatgacgtcaat
gatgaaggtaaaaaccaagtattggaaagtttcatacctcacatctgtgccctggttatt
gattcaagagtgaatttttgcattcagcaagaggctttaaaaaaaatgaatttgatgctt
gacagaatacctcaagatgccaacaaaatactttgtaatcaagaaatattaactctcatg
agtaatatgggagaaaggattttagatgtaggagattatgaattacaggtaggcattgtg
gaagctttgtgtagaatgactaccgaaaaacggaggcaggagctggcatatgaatggttt
tcaatggactttattgctaatgcatttaagaaaattaaagactgtgaatttgaaacagat
tgcagaatatttctcaacttggtaaacggcatgctgggtgacagaagaagggtctttaca
tttccttgcttgtcagcatttcttggtaaatatgagctgcagataccatcagatgaaaaa
cttgaggaattctggattgattttaatctcgggagccacactctgtcattctacattgct
ggagatgatgatgatcaccaatgggaagctgtcactgtgcctgaagaaaaagttgatatg
tacaacattgaagtgagagaatcaaagaagctactgactctaactttgaaaaatatagta
aaaattagtaaaaaagaaggaaaagagttacttttgtattttgatgcagcattagaaatc
accaatgtgactaaaaaactttttggtggaaataagtataaggaatttaccagaaaacaa
gatatttcagttgccaaaacatccattcatgtactttttgatgcaagtggatcacagatt
ctagtaccagaaagtcaaccatctccagtcaaagaaaacctcattcatctaaaagagaaa
tctaacctccaaaagaaacttacaaaccctctagaaccagacaacagcagcagccagcgc
gacaggaaaaacagccaggatgagatcactacacctagcagaaagaaaatgtctgaagca
tcaatgattgttcccgatacagacagatacactgtgcgaagtccaatactcttaatcaac
acatcaaccccgcgaagaagtagggcaccactgcaagcaatacattctgctgagaaggct
gtttctaaaacatcagaaagtggagtggattatgctgtgtcactcaaatctagacaatct
gatggaagaaatagagggaacaatagagccaatcataacaaaactgctacagtacaaaac
aaaggacatgagcaccatgaatccccagaccaaactttcaatgaaattgaggaaactctc
tctgatgcatatgcagtggaaaaagtagacaagcctgtattacctggtgttttagacatc
tcgaaaaataaagcacattccagatgggcatgttggacacctgtaacaactatcaaactc
tgcaataaccagagatcctgtgctttaccaggagatacttttacccaagatactggtgtc
aacaaaaaatgcactaaacaaaaatcagtatctgatgatgattctgaagaaacacaaagg
gtaaaatatagtaaagatgtcatcaagtgtaacaagtcagaagaagcagaagtttgtgaa
agaaacattcaagaacaaaatcatcctaaatattcacaaaagaaaaatactgcaaatgca
aagaagaatgattggcatattgaatctgaaacaacttataaatcagtactcctaaataag
acaactgaagaatcactcatctataagaagacgtgtgtattgtcaaaagatgtgaatact
actatctgtgataaaagcccttctagaaaaagcatgaggagccatacaaagtcaaggaaa
gaactgatgtctgaagttacttcatgtgagctagatgaaataccagtgagagaaaattca
aaagggaaaagatttactggtacagcagaatccttgataaacctaattaataagaggtat
aactcaagtgatgacatgatatcaacaagaaaactgaaggagcctcgggatggcagtggg
ttttcaaagaaacctgaactgcagttcaataaggttcagagaaagagttacagaaaactg
aagactgttgttaatgttacttctgaatgtccactgaatgatgtatataatttcagcttg
aatggagccgatgagcctgttataaaacttggaatccaagaatttcaagctacaactaga
gaagctagtatggataattcaataaaattggtagatgtaaggaaccgtgatgaacgtgac
ctttctctcaaaacaaaagatgaaagaatattaagtcatgagaggaaaactctcttcagt
gacactgaaacagaatgtggttgggatgacagcaagactgacattagctggctaaggaaa
ccaaaatcaaaaagactaatggattatagtagaaataaaaacacaaaaaaatgtaaaagt
ataaaatcaaggtcatccacggaaaagggacagccaagatccacagtggtactcagtaaa
aacattgcgaaaaatgattatgaagtaattgtagatgggagaaccagacttccacgaaga
gcaacaaaaacaaaaaaaaattacaaagatctctcaacttcaggatcagaatcagagagt
gaaaaagaaatttcatatttgtttaaagataaactaccaacaaaggaggagactgtccat
tccagcgcccaaacaaagaaactgcccaagaaacaacagaaagtcttcaatacagaagcg
ctgaaaggacagccttcagaagaacagaaaaattcatctacgctaagaaatgggagagaa
gacagtctgtacttgtcttctgcatctgtgtctgggagctcgtcatctgtggaagtgatg
agatgtacagagaaaataacagaaagggattttactcaggattatgactacatcacaaag
tctctttcaccatatccaaaagctgcatcacctgaattcttaaacagaagcaatagagtg
gtaggtcatggaaaatcaccaagaattagtgagaccagtgcagtatgtgtgagaaagagt
tgctcacctgcttcaggactgcccttttcgcccagacacacaaccaagaataattctgtt
atgaatataaaaaatacaaattcagtgataaataatcaaagaacccaacattgtaacagc
tattcagatgtaagcagtaacagttcagagaaactttatatggaacccgaatctccggat
agctgtgaaaaccatgtgcaaagcaagagagaggaaaatcatgcagcctctccattttca
ttgtctagtgaaaaaatagagaaaatatggtttgacatgcccaatgacaatactcatgta
tcaggtcccagtcaacgtggtagcaaaagacggatgtacctagaagaagatgagctaagt
aatcccagtgaagcagaagtgcaagaggcagaagaaagggaacatttggtttccaaaaaa
ctatgtcaaagggaacatttcgatcagcatacctctgaaacttcattatcaacaccagag
ttttctgttcctaaggactggcaacaggagttacaaggtgctgggatgttttatgataac
atcaactcagattataaaaggaaaactgacacacaacataaaatcatggatgattttact
acaaagacattgaaactgactcaacaacatctgttggcaatggcctgtcaagctcgggga
cacagggatgaaaatattgacaaattccaagtcactctcctagatgagctggaaaaagtt
gaaaaagactcacagactttacgagacttggagaaagagtttgtggacatcgaagaaaag
atagttcacaagatgagggcatttcaccaaagtgagcgagaaaggtttcgtgctttgaaa
acttcattggataaaagtttgcttgtctataattctgtttatgaagagaatgttcttaca
tctgagatgtgtttgatgaaagcaaacatgaaaatgctacaagacaagctactgaaggag
atgcatgaagaggaacttctcaacatacgcagaggactggagtcattattcaaggatcat
gaaggaaacaatgcatga

DBGET integrated database retrieval system