KEGG   Rattus norvegicus (rat): 83826Help
Entry
83826             CDS       T01003                                 

Gene name
Nr5a1, Ad4BP/SF-1, Ad4bp, Ftzf1, Sf-1
Definition
(RefSeq) nuclear receptor subfamily 5, group A, member 1
  KO
K08560  steroidogenic factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04927  Cortisol synthesis and secretion
rno04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    83826 (Nr5a1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    83826 (Nr5a1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    83826 (Nr5a1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    83826 (Nr5a1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Cys4 Fushi tarazu-F1-like
    83826 (Nr5a1)
Nuclear receptors [BR:rno03310]
 5. Fushi tarazu-F1 like
  5A. Fushi tarazu-F1 like receptor
   83826 (Nr5a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 83826
NCBI-ProteinID: NP_001178028
RGD: 68350
Ensembl: ENSRNOG00000012682
UniProt: P50569
Position
3q12
AA seq 462 aa AA seqDB search
MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKT
QRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKL
ETGPPMGVPPPPPPPPDYMLPPSLHAPEPKALVSGPPSGPLGDFGAPSLPMAVPGPHGPL
AGYLYPAFSNRTIKSEYPEPYASPPQQPGPPYSYPEPFSGGPNVPELILQLLQLEPEEDQ
VRARIVGCLQEPAKSRPDQPAPFSLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQ
NCWSELLVLDHIYRQVQYGKEDSILLVTGQEVELSTVAVQAGSLLHSLVLRAQELVLQLH
ALQLDRQEFVCLKFLILFSLDVKFLNNHSLVKDAQEKANAALLDYTLCHYPHCGDKFQQL
LLCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggactattcgtacgacgaggacctggacgagctgtgtccagtgtgtggtgacaaggtg
tcgggctaccactacgggctgctcacgtgcgagagctgcaagggcttcttcaagcgcaca
gtccagaacaacaagcattacacgtgcaccgagagtcagagctgcaaaatcgacaagacg
cagcgtaagcgctgtcccttctgccgcttccagaagtgcctgacggtgggcatgcgcctg
gaagctgtgcgtgctgatcgaatgcggggcggccggaacaagtttgggcccatgtacaag
agagaccgggccttgaagcagcagaagaaagcacagattcgggccaatggcttcaaactg
gagaccggaccaccgatgggggttcccccgccaccccctcccccaccggactacatgtta
ccccctagcctgcatgcaccggagcccaaggccctggtctctggcccacccagtgggccg
ctgggtgactttggagccccatctctgcccatggccgtgcctggtccccacgggcctctg
gctggctacctctatcctgccttctctaaccgcaccatcaagtctgagtatccagagccc
tacgccagcccccctcaacagccagggccaccctacagctatccggagcccttctcagga
gggcccaatgtaccagagctcatattgcagctgctgcaactagagccagaggaggaccag
gtgcgtgctcgcatcgtgggctgcctgcaggagccagccaaaagccgccctgaccagcca
gcgcccttcagcctcctctgcaggatggcggaccagacctttatctccattgtcgactgg
gcacgaaggtgcatggtatttaaggagctggaggtggctgaccagatgacactgctgcag
aactgctggagtgagctgctggtgctggaccacatctaccgccaggtccagtacggcaag
gaagacagcatcttgctggtcactggacaggaggtggagctgagcacggtggctgtgcag
gctggctccctgctgcacagcctggtgctgcgggcacaggagttggtgctgcagctgcat
gccctgcaactggaccgccaggagtttgtctgtctcaagttcctcatcctcttcagcctc
gatgtgaaattcctgaacaaccacagcctggtaaaggacgcccaggagaaggccaacgcc
gccctgctggattacaccttgtgtcactacccacactgcggggacaaattccagcagttg
ctattgtgcctggtggaggtgcgggcactgagcatgcaggccaaggagtatctgtaccat
aagcatttgggcaacgagatgccccgcaacaaccttctcattgagatgctgcaggccaag
cagacttga

DBGET integrated database retrieval system