KEGG   Rattus norvegicus (rat): 83837
Entry
83837             CDS       T01003                                 

Gene name
Bambi
Definition
(RefSeq) BMP and activin membrane-bound inhibitor homolog precursor
  KO
K10162  BMP and activin membrane-bound inhibitor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    83837 (Bambi)
   04350 TGF-beta signaling pathway
    83837 (Bambi)
SSDB
Motif
Pfam: BAMBI_C BAMBI Activin_recp LapA_dom
Other DBs
NCBI-GeneID: 83837
NCBI-ProteinID: NP_620782
RGD: 621831
Ensembl: ENSRNOG00000016066
UniProt: Q91XN4
Position
17
AA seq 260 aa
MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQN
TNSPLTHGCLDSLASTADICRAKQAQNHSGPTMPTLECCHEDMCNYRGLHDVLSPPKSEA
SGQGNRYQHDSSRNLITKVQELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSEN
KRLQDQRQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGQENCCLTCDKMRQADLSNE
KILSLVHWGMYSGHGKLEFV
NT seq 783 nt   +upstreamnt  +downstreamnt
atggatcgccactccagctacatcttcatctggctgcagttggagctctgcgccatggct
gtgctgctcaccaaaggcgagatcagatgctactgtgatgccgctcactgtgtggcaact
ggttacatgtgtaagtccgagcttagtgcctgcttctccagactccttgatcctcagaac
accaattccccactaacccacggctgcctggactcactcgcaagcacagcagacatctgc
cgagccaaacaggcccaaaaccactctggtcccaccatgcccactttggaatgctgtcat
gaagacatgtgcaattaccgaggactgcatgatgtcctctctcctcccaagagtgaagcc
tcaggacaaggaaacagataccagcatgacagcagcagaaacctcatcactaaggtgcag
gagctgacttcctccaaagaactgtggttccgtgcagccgtgatcgcggttcccattgct
ggcggactgatcttggtgctgctcattatgttggccttgcgaatgctgcgaagtgagaac
aagaggctgcaggatcagcggcagcagatgctctctcgtttgcactacagcttccatgga
caccactccaagaagggacaggttgcaaagttggacttagagtgcatggtgcccgtcagt
gggcaggagaactgctgtctgacctgcgacaaaatgaggcaagcagatctcagcaacgag
aagatcctctcccttgtgcactggggcatgtacagtggtcatgggaagctggaattcgta
tga

DBGET integrated database retrieval system