KEGG   Rattus norvegicus (rat): 83839Help
Entry
83839             CDS       T01003                                 

Gene name
Calb1, CaBP28K
Definition
(RefSeq) calbindin 1
  KO
K14757  calbindin D28
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04961  Endocrine and other factor-regulated calcium reabsorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    83839 (Calb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 83839
NCBI-ProteinID: NP_114190
RGD: 69340
Ensembl: ENSRNOG00000007456
UniProt: P07171
Structure
PDB: 

Position
5q13
AA seq 261 aa AA seqDB search
MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELLQARKKAGLELSPEMKT
FVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIET
EELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLK
FQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQELDINNISTYKKNIMA
LSDGGKLYRTDLALILSAGDN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatcccacctgcagtcatctctgatcacagcctcacagttttttgagatctgg
cttcatttcgacgctgatggaagtggttacctggaaggaaaggagctgcagaacttgatc
caggagcttctgcaggcacgaaagaaggctggattggagctatcacctgagatgaaaacc
tttgtggatcaatatgggcagagagatgatgggaaaataggaattgtagagttggcccat
gtcttacccaccgaagagaatttcctgctgctctttcgatgccagcaactgaagtcctgc
gaggaattcatgaagacttggagaaagtatgacactgaccacagtggcttcatagaaacg
gaggaacttaagaactttcttaaggacctgctagagaaagcaaacaagaccgtggatgat
acgaaacttgctgagtacacagacctcatgctgaagctgttcgactcaaataatgatggg
aagctggagctgacagagatggccaggttactaccagtgcaggaaaatttccttcttaaa
ttccagggaatcaaaatgtgtgggaaagagttcaataaggcttttgagttatatgatcag
gatggcaacggatacatagatgaaaatgagctggatgccttactgaaagacctgtgtgag
aaaaacaaacaggaattggatattaacaatatttctacatacaagaagaacataatggcc
ttgtcggatggagggaagctgtaccgaacagatcttgcccttattctctctgctggggac
aactag

DBGET integrated database retrieval system