KEGG   Rattus norvegicus (rat): 83839
Entry
83839             CDS       T01003                                 

Gene name
Calb1, CaBP28K
Definition
(RefSeq) calbindin 1
  KO
K14757  calbindin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04961  Endocrine and other factor-regulated calcium reabsorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    83839 (Calb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    83839 (Calb1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   83839 (Calb1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8
Other DBs
NCBI-GeneID: 83839
NCBI-ProteinID: NP_114190
RGD: 69340
Ensembl: ENSRNOG00000007456
UniProt: P07171
Structure
PDB: 
2G9B 2F33

Position
5q13
AA seq 261 aa
MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELLQARKKAGLELSPEMKT
FVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIET
EELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLK
FQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQELDINNISTYKKNIMA
LSDGGKLYRTDLALILSAGDN
NT seq 786 nt   +upstreamnt  +downstreamnt
atggcagaatcccacctgcagtcatctctgatcacagcctcacagttttttgagatctgg
cttcatttcgacgctgatggaagtggttacctggaaggaaaggagctgcagaacttgatc
caggagcttctgcaggcacgaaagaaggctggattggagctatcacctgagatgaaaacc
tttgtggatcaatatgggcagagagatgatgggaaaataggaattgtagagttggcccat
gtcttacccaccgaagagaatttcctgctgctctttcgatgccagcaactgaagtcctgc
gaggaattcatgaagacttggagaaagtatgacactgaccacagtggcttcatagaaacg
gaggaacttaagaactttcttaaggacctgctagagaaagcaaacaagaccgtggatgat
acgaaacttgctgagtacacagacctcatgctgaagctgttcgactcaaataatgatggg
aagctggagctgacagagatggccaggttactaccagtgcaggaaaatttccttcttaaa
ttccagggaatcaaaatgtgtgggaaagagttcaataaggcttttgagttatatgatcag
gatggcaacggatacatagatgaaaatgagctggatgccttactgaaagacctgtgtgag
aaaaacaaacaggaattggatattaacaatatttctacatacaagaagaacataatggcc
ttgtcggatggagggaagctgtaccgaacagatcttgcccttattctctctgctggggac
aactag

DBGET integrated database retrieval system