KEGG   Rattus norvegicus (rat): 84006
Entry
84006             CDS       T01003                                 

Gene name
Prkci, Pkcl
Definition
(RefSeq) protein kinase C, iota
  KO
K06069  atypical protein kinase C iota type [EC:2.7.11.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04144  Endocytosis
rno04390  Hippo signaling pathway
rno04530  Tight junction
rno04611  Platelet activation
rno04910  Insulin signaling pathway
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    84006 (Prkci)
   04390 Hippo signaling pathway
    84006 (Prkci)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    84006 (Prkci)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    84006 (Prkci)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    84006 (Prkci)
  09152 Endocrine system
   04910 Insulin signaling pathway
    84006 (Prkci)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    84006 (Prkci)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    84006 (Prkci)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     84006 (Prkci)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   84006 (Prkci)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 C1_1 Pkinase_C Kinase-like APH C1_2 Kdo
Other DBs
NCBI-GeneID: 84006
NCBI-ProteinID: NP_114448
RGD: 620961
Ensembl: ENSRNOG00000009652
UniProt: F1M7Y5
Position
2q24
AA seq 596 aa
MPTQRDSSTMSHTVACGGGGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCSEVRDMCSF
DNEQPFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGE
DKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHK
KCHKLVTIECGRHSLPPEPMMPMDQSSMHPDHTQTVIPYNPSSHESLDQVGEEKEAMNTR
ESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQ
TEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSA
EISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYI
APEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIR
IPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFK
PNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgccgacccagagggacagcagcaccatgtctcacacggtcgcgtgcggcggcggcggg
gaccattcccaccaggtccgggtgaaagcctactaccgcggggatattatgataacacac
ttcgagccttccatctcctttgaaggactttgcagtgaggttcgagatatgtgttctttt
gacaatgagcagccattcaccatgaaatggatagatgaggaaggagacccgtgcacagtg
tcttctcagttggagttggaagaggctttcaggctgtatgagttgaacaaggattctgaa
ctcctgatccacgtgttcccgtgtgtaccagagcgtcctggaatgccttgcccaggggaa
gacaagtccatttaccgcagaggggcgcgcaggtggagaaagctgtattgtgcaaatggc
cacacttttcaagccaaacgctttaacaggcgtgcccactgtgccatctgcacagacagg
atctggggacttggacgacaaggatataaatgcatcaactgcaaactgctggttcataag
aagtgccacaagcttgtcacaattgagtgtgggcggcattctttgccaccggaacccatg
atgccaatggaccagtcatccatgcacccagaccacacacagacagtaattccatataat
ccttcaagtcatgagagtttggaccaagttggtgaagaaaaggaggcaatgaacaccagg
gagagtgggaaggcgtcatcaagcttaggtctccaggatttcgatttgcttcgagttata
gggagaggaagttacgccaaagtactgctggttcgattaaaaaagacagatcgcatttat
gcaatgaaggttgtgaagaaagagctcgtcaatgacgatgaggatattgattgggtacag
acagaaaagcatgtgtttgagcaggcgtccaatcaccctttccttgttggtctgcattcc
tgcttccagacagaaagcaggctgttttttgtcatagaatatgtgaatggaggggatctc
atgtttcatatgcagcggcaaagaaaacttcctgaagaacatgccaggttttactcagca
gaaatcagtctagcactaaattatcttcatgagcgagggataatttatagagatttgaag
ttggacaatgtactgctggactctgaaggacacatcaaactcactgactacggcatgtgt
aaggaaggattacggcccggagatacaaccagcaccttctgtgggactcccaattacatt
gctcctgagatcttaagaggagaagactatggcttcagcgttgactggtgggctcttgga
gtactcatgtttgagatgatggcgggaaggtctccatttgatatcgttgggagctctgac
aatcctgaccaaaacacagaggattatctgttccaagtcattttggagaagcagattcgc
ataccgcgctccctgtctgtgaaagcagcaagtgtgctgaagagtttcctcaacaaggac
ccaaaggaacgattgggttgtcaccctcaaactggatttgctgacatccaaggacaccca
ttcttccgtaatgtggattgggacatgatggagcagaagcaagtggttccgccctttaaa
ccaaacatttctggagaatttggtttggataactttgactcccagtttaccaacgaacca
gtccagctcactccagatgatgatgacatcgtgaggaagattgatcagtctgaatttgaa
ggtttcgagtatatcaaccctctcttgatgtctgcagaagagtgtgtctga

DBGET integrated database retrieval system