KEGG   Rattus norvegicus (rat): 84007
Entry
84007             CDS       T01003                                 

Gene name
C3ar1
Definition
(RefSeq) C3a anaphylatoxin chemotactic receptor
  KO
K04009  C3a anaphylatoxin chemotactic receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04610  Complement and coagulation cascades
rno05150  Staphylococcus aureus infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    84007 (C3ar1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    84007 (C3ar1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    84007 (C3ar1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    84007 (C3ar1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    84007 (C3ar1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Anaphylatoxin
    84007 (C3ar1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srw 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 84007
NCBI-ProteinID: NP_114449
RGD: 620537
Ensembl: ENSRNOG00000009211
UniProt: O55197
Position
4
AA seq 472 aa
MESFTADTNSTDLHSRPLFKPQDIASMVILSLTCLLGLPGNGLVLWVAGVKMKRTVNTVW
FLHLTLADFLCCLSLPFSVAHLILRGHWPYGLFLCKLIPSVIILNMFASVFLLTAISLDR
CLMVHKPIWCQNHRSVRTAFAVCGCVWVVAFVMCIPVFVYRDLLVVDDYSVCGYNFDSSR
AYDYWDYMYNSHLPEINPPDNSTGHVDDRTAPSSVPARDLWTATTALQSQTFHTSPEDPF
SQDSASQQPHYGGKPPTVLIATIPGGFPVEDHKSNTLNTGAFLSAHTEPSLTASSSPLYA
HDFPDDYFDQLMYGNHAWTPQVAITISRLVVGFLVPFFIMITCYSLIVFRMRKTNLTKSR
NKTLRVAVAVVTVFFVCWIPYHIVGILLVITDQESALREVVLPWDHMSIALASANSCFNP
FLYALLGKDFRKKARQSVKGILEAAFSEELTHSTSCTQDKAPSKRNHMSTDV
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggagtctttcactgctgacaccaactcaactgacctacactcacggcctctgtttaaa
ccccaagacattgcctccatggtcattctcagtctcacgtgtttattgggactgccaggc
aatgggctggtgctgtgggtcgctggcgtaaagatgaagaggaccgtgaacacagtctgg
ttcctccacctcaccctggccgatttcctctgctgcctctccttgcccttctccgtggct
cacctgattctccgaggacactggccctatggcttgttcctgtgcaaacttatcccgtcc
gtcattatcctcaacatgtttgccagtgtcttcctgcttactgccattagcctggaccgc
tgtctgatggtgcacaagccgatctggtgccagaaccatcggagcgtgagaacagccttc
gccgtctgtggatgcgtctgggtggtagcctttgtgatgtgtataccggtatttgtatac
cgtgatctgctcgttgtggatgattacagtgtatgtggctataactttgattcctccagg
gcatatgattattgggactacatgtacaattcacatctaccagaaatcaaccctcctgac
aactccactggacatgtggatgacaggacagctccttcctctgtaccagcaagggacctt
tggacagctaccactgctctccagtcacaaacgttccacacatctcctgaagacccattc
tctcaagactcagcaagtcagcaaccccattatggggggaagcctcctactgtgctcata
gccaccatacccggcgggtttcctgttgaagatcataaatccaacacactgaacactggt
gcttttctctctgcccacacagagccgtccctcactgcttctagcagtcctttatacgcc
catgatttcccggatgattattttgaccaactgatgtatggcaatcacgcgtggacacct
caggtggcaatcaccatctcgaggctggtggtgggcttcctggtgccctttttcatcatg
ataacctgttacagcctcatcgtcttcagaatgcgaaaaaccaacctcaccaagtcgagg
aacaaaacccttcgggtggccgtggcggtggtcaccgtcttttttgtctgctggattcca
taccatattgttggaatcctgttagtgattactgaccaagaaagcgccttgagagaagtt
gtgctaccctgggaccacatgtccattgctttagcatctgccaatagttgtttcaaccct
ttcctttatgccctcttgggaaaagacttcaggaagaaagcaagacagtccgtaaagggc
attctggaagcagccttcagcgaagagctcacgcactctaccagttgtacccaggacaaa
gccccctcaaaaagaaaccatatgagtacggatgtgtga

DBGET integrated database retrieval system