KEGG   Rattus norvegicus (rat): 84008
Entry
84008             CDS       T01003                                 

Gene name
Cntnap1, Caspr
Definition
(RefSeq) contactin associated protein 1
  KO
K07379  contactin associated protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    84008 (Cntnap1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    84008 (Cntnap1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Laminin domain-containing proteins
  Laminin G domain-containing proteins
   84008 (Cntnap1)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 F5_F8_type_C EGF DUF3919
Other DBs
NCBI-GeneID: 84008
NCBI-ProteinID: NP_114450
RGD: 70902
Ensembl: ENSRNOG00000020277
UniProt: P97846
Position
10q31
AA seq 1381 aa
MMSLRLFSILLAAVVSGAQGWGYYGCNEELVGPLYARSLGASSYYGLFTTARFARLHGIS
GWSPRIGDPNPWLQIDLMKKHRIRAVATQGAFNSWDWVTRYMLLYGDRVDSWTPFYQQGH
NATFFGNVNDSAVVRHDLHYHFTARYIRIVPLAWNPRGKIGLRLGIYGCPYTSNILYFDG
DDAISYRFQRGASQSLWDVFAFSFKTEEKDGLLLHTEGSQGDYVTLELQGAHLLLHMSLG
SSPIQPRPGHTTVSAGGVLNDLSWHYVRVDRYGREANLTLDGYVHRFVLNGDFERLNLEN
EIFIGGLVGAARKNLAYRHNFRGCIENVIYNRINIAEMAVQRHSRITFEGNVAFRCLDPV
PHPINFGGPHNFVQVPGFPRRGRLAVSFRFRTWDLTGLLLFSRLGDGLGHVELMLSEGQV
NVSIAQTGRKKLQFAAGYRLNDGFWHEVNFVAQENHAVISIDDVEGAEVRVSYPLLIRTG
TSYFFGGCPKPASRWGCHSNQTAFHGCMELLKVDGQLVNLTLVEFRKLGYFAEVLFDTCG
ITDRCSPNMCEHDGRCYQSWDDFICYCELTGYKGVTCHEPLYKESCEAYRLSGKYSGNYT
IDPDGSGPLKPFVVYCDIRENRAWTVVRHDRLWTTRVTGSSMDRPFLGAIQYWNASWEEV
SALANASQHCEQWIEFSCYNSRLLNTAGGYPYSFWIGRNEEQHFYWGGSQPGIQRCACGL
DQSCIDPALHCNCDADQPQWRTDKGLLTFVDHLPVTQVVIGDTNRSSSEAQFFLRPLRCY
GDRNSWNTISFRTGAALRFPPIRANHSLDVSFYFRTSAPSGVFLENMGGPFCQWRRPYVR
VELNTSRDVVFAFDIGNGDENLTVHSDDFEFNDDEWHLVRAEINVKQARLRVDHRPWVLR
PMPLQTYIWLEYDQPLYVGSAELKRRPFVGCLRAMRLNGVTLNLEGRANASEGTFPNCTG
HCTHPRFPCFHGGRCVERYSYYTCDCDLTAFDGPYCNHDIGGFFETGTWMRYNLQSALRS
AAQEFSHMLSRPVPGYEPGYIPGYDTPGYVPGYHGPGYRLPDYPRPGRPVPGYRGPVYNV
TGEEVSFSFSTSSAPAVLLYVSSFVRDYMAVLIKEDGTLQLRYQLGTSPYVYQLTTRPVT
DGQPHSVNITRVYRNLFIQVDYFPLTEQKFSLLVDSQLDSPKALYLGRVMETGVIDPEIQ
RYNTPGFSGCLSGVRFNNVAPLKTHFRTPRPMTAELAEAMRVQGELSESNCGAMPRLVSE
VPPELDPWYLPPDFPYYHDDGWIAILLGFLVAFLLLGLVGMLVLFYLQNHRYKGSYHTNE
PKATHDSHPGGKAPLPPSGPAQAPAPTPAPTQVPTPAPAPASGPGPRDQNLPQILEESRS
E
NT seq 4146 nt   +upstreamnt  +downstreamnt
atgatgagtctccggcttttcagcattctgctcgccgctgtggtctctggagcccagggc
tggggctactatggctgcaatgaggagctggtggggcctctgtatgcacggtctctgggt
gcttcctcctactatggactctttaccacagcccgctttgcccggctacacggcatcagt
ggatggtcgccccggattggggacccgaatccctggctccagatagacttaatgaagaag
catcgaatccgggctgtggccacacagggagcctttaattcttgggattgggtcacacgt
tacatgctgctctacggggaccgtgtggacagctggacaccattctaccaacaagggcac
aacgcgaccttcttcggtaatgtcaacgactcggcggtggtacgccatgacctgcactac
cattttacggctcgctacatccgcatcgtgccactggcctggaacccccgcggcaagatt
ggcttgaggctgggcatctacggttgtccctacacgtccaacatcctgtattttgacggc
gatgatgccatttcataccgcttccagcgaggggccagtcaaagtctttgggacgtgttc
gcttttagtttcaagacagaggagaaggacgggctgctgttgcacaccgaaggctcccag
ggggattatgtgacgcttgaactgcaaggagcacacctgctgctgcacatgagcctgggc
agcagccccatccagccgagacctggtcacaccacggtgagcgctggtggcgtacttaat
gacctaagctggcattatgtgcgggtggaccgatacggccgagaagcaaatctcaccctg
gatggttacgtacatcgctttgtgctcaacggcgactttgaaaggctgaatctcgaaaat
gagatattcatcggaggtctagtgggcgcagcgcgtaagaacctggcctaccgccataac
ttccgtggctgtatagaaaacgtgatctacaaccggatcaacatagctgaaatggcagtg
cagcgccattcgcggatcaccttcgagggtaatgtggctttccggtgcttggatcccgtt
ccacaccccatcaacttcggaggccctcacaacttcgtccaagtgcctggctttccacgt
cgaggccgccttgctgtctccttccgcttccgcacctgggacctcacagggctgctcctt
ttctcccgcttgggggatgggctgggtcatgtggagctgatgcttagtgaagggcaagtc
aatgtatccatcgcgcagactggccgcaagaagcttcagtttgctgcggggtaccgcctg
aatgatggcttctggcatgaggtgaactttgtggcacaggaaaaccatgcggtcatcagt
attgatgatgtggagggggcagaggtcagggtatcatacccactgctgatccgcacaggg
acttcatacttctttggtggttgtcccaaaccagccagtcgatggggctgccactccaac
cagacagcattccatggctgcatggagctgctcaaggtggatggtcaactggtcaacctc
actctggtagagtttcggaagcttggttactttgctgaggtcctctttgacacatgtggc
atcacagacagatgcagccctaatatgtgtgagcatgatgggcgctgctaccagtcttgg
gatgacttcatctgctactgcgaactcaccggctacaagggagttacctgccatgaacca
ttgtataaggagtcctgtgaagcctatcgcctcagcgggaaatattctggaaattacacc
attgatcctgatggcagtggacccctgaaaccatttgtagtgtattgtgatatccgagag
aaccgagcatggacagttgtgcgacatgacaggctatggaccactcgagtgacaggttcc
agcatggaccggccctttctgggggccatccaatactggaatgcctcctgggaggaagtc
agtgctctggccaatgcttcccagcactgtgagcagtggatcgagttctcctgctacaat
tcccggctgctcaacactgcaggaggctacccctacagcttttggattggccgaaatgaa
gaacagcatttctactggggaggctcccagcctgggatccaacgctgtgcctgtgggctg
gaccagagctgtatagaccctgcactgcactgcaactgcgatgctgaccagccacagtgg
agaacagacaaggggctcctgacctttgtggaccatctgcctgtcactcaggtagtgata
ggtgacacaaaccgctccagctctgaagctcagttcttcctgaggcctctgcgctgttat
ggtgaccgcaattcctggaacactatctccttccgcactggagctgcactgcgtttccct
ccaatccgtgccaaccacagccttgatgtctccttctacttcaggacctcggctccctca
ggagtcttcctagagaacatggggggtcctttctgccagtggcgccgaccttacgtgaga
gtggagctcaacacatcccgggatgtggtctttgcctttgatattggcaatggggatgag
aacctgacagtgcactcagatgacttcgagttcaatgatgacgagtggcatttggtccgg
gctgaaatcaacgtgaagcaggcccggctgcgagtggaccatcggccctgggtgctaagg
cccatgcccctgcagacgtacatctggctggagtatgaccaacccctctatgtgggatct
gcagagcttaagaggcgcccatttgtggggtgcttgagggccatgcgtttgaatggagtg
actctgaacttggagggtcgtgccaatgcctccgagggcaccttccccaactgcacgggc
cactgcacccacccccggttcccctgtttccacggaggacgctgtgtggagcgatacagc
tactacacgtgtgactgtgacctcacagcttttgatggaccatattgtaatcacgatatt
ggtggattctttgagactggcacatggatgcgctataacctccagtcagcactgcgttct
gcggcccaggagttctctcacatgctgagccggccggtaccgggctatgagcctggctat
atcccaggctacgacactcctggttacgtgcctgggtaccatggtcctgggtaccgccta
cccgactacccaaggcctggccggccagtgcccggataccgggggcccgtgtacaatgtt
actggagaggaggtctcctttagcttcagcaccagctctgctcctgcagtcctgctctac
gtcagctcctttgtgcgtgactacatggccgtgctcatcaaggaagatgggaccctacag
cttcgctatcagctgggcaccagtccctatgtgtaccagctaaccacccggccagtgacc
gatggccaaccccatagtgtcaacatcacccgggtctaccgaaacctctttatccaggtg
gactacttcccgctgacagaacagaagttctctctcctggtggacagccagctggactcc
cccaaggccttgtatctagggcgtgtgatggagacaggagtcattgacccagagattcag
cggtacaacaccccaggtttctcaggctgcctgtctggtgtccggttcaacaatgtggct
cctctcaagacccatttccgaacccctcgccccatgactgctgagctggcggaggccatg
cgggttcaaggagaactgtcggagtctaactgtggcgctatgccacgccttgtctccgag
gtgccaccagagcttgatccctggtacctgcccccagatttcccatactaccatgacgac
ggatggattgccatactcttaggttttttggtggccttcctgctgctggggcttgtggga
atgctggtgctgttctatctgcaaaatcatcgatacaagggctcctatcacaccaacgag
cccaaggccacccatgattcccaccctggcggcaaagctcccctacctccctcaggccct
gcccaggcccctgcccccactccagctcccacccaggttccgaccccagccccagcccca
gcctctggcccaggccccagggaccagaacctcccccagatcttggaggagtccaggtct
gaatga

DBGET integrated database retrieval system