KEGG   Rattus norvegicus (rat): 84016Help
Entry
84016             CDS       T01003                                 

Gene name
Grip1
Definition
(RefSeq) glutamate receptor interacting protein 1
  KO
K20251  glutamate receptor-interacting protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    84016 (Grip1)
Membrane trafficking [BR:rno04131]
 Protein recycling
  Others
   Glutamate receptor-interacting proteins (GRIPs)
    84016 (Grip1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_6 PDZ_2 Tricorn_PDZ
Motif
Other DBs
NCBI-GeneID: 84016
NCBI-ProteinID: NP_114458
RGD: 621667
Ensembl: ENSRNOG00000004013
UniProt: P97879
Structure
PDB: 

Position
7q22
AA seq 1112 aa AA seqDB search
MIAVSFKCRCQILRRLTKDESPYTKSASQTKPPDGALAVRRQSIPEEFKGSTVVELMKKE
GTTLGLTVSGGIDKDGKPRVSNLRQGGIAARSDQLDVGDYIKAVNGINLAKFRHDEIISL
LKNVGERVVLEVEYELPPVSIQGSSVMFRTVEVTLHKEGNTFGFVIRGGAHDDRNKSRPV
VITCVRPGGPADREGTIKPGDRLLSVDGIRLLGTTHAEAMSILKQCGQEATLLIEYDVSV
MDSVATASGPLLVEVAKTPGASLGVALTTSVCCNKQVIVIDKIKSASIADRCGALHVGDH
ILSIDGTSMEYCTLAEATQFLANTTDQVKLEILPHHQTRLALKGPDHVKIQRSDRQLPWD
PWASSQCSVHTNHHHNPHHPDHCRVPALGFPKALTPNSPPAMVSSSSPTSMSAYSLSSLN
MGTLPRSLYSTSPRGTMMRRRLKKKDFKSSLSLASSTVGLAGQVVHTETTEVVLTADPVT
GFGIQLQGSVFATETLSSPPLISYIEADSPAERCGVLQIGDRVMAINGIPTEDSTFEEAN
QLLRDSSITSKVTLEIEFDVAESVIPSSGTFHVKLPKKHSVELGITISSPSSRKPGDPLV
ISDIKKGSVAHRTGTLELGDKLLAIDNIRLDSCSMEDAVQILQQCEDLVKLKIRKDEDNS
DEQESSGAIIYTVELKRYGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRIL
AINSSSLKGKPLSEAIHLLQMAGETVTLKIKKQTDAQPASSPKKLPIPSHSSDLGDGEED
PSPIQRPGKLSDVYPSTVPSVDSAVDSWDGSGIDARYGSQGTTFQTSGYNFNTYDWRSPK
KRASLSPVPKPRSQTYPDVGLSNEDWDRSTASGFAGASDSADAEQEENFWSQALEDLETC
GQSGILRELEATIMSGSTMSLNHEAPTARSQLGRQASFQERSNSRPHYSQTTRSNTLPSD
VGRKSVTLRKMKQEIKEIMSPTPVELHKVTLYKDSGMEDFGFSVADGLLEKGVYVKNIRP
AGPGDLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRNPLASQKSIEQP
ALPSDWSEQNSAFFQQPSHGGNLETREPTNTL
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atgatagctgtctcttttaaatgccgctgtcagattctaaggcgacttaccaaagatgag
agtccctacactaaatctgccagccagacaaagccgcccgatggagcattggctgtgagg
agacagagcatcccagaggaattcaagggctccaccgtggtggagctgatgaagaaggag
ggaaccactcttggcctgacggtatcaggaggaatcgataaagatggaaagccaagagtg
tccaacctgcggcagggagggattgctgccagaagtgaccagctggatgtgggcgactac
atcaaagcggtgaatgggatcaacctggccaaattccgccatgatgagatcatcagcctg
ctgaaaaatgttggggaaagagtggtcctggaggtcgagtatgagcttccaccggtctct
atccaaggatcgagtgttatgttccgaacagtggaggtcaccttgcacaaagaaggcaac
acctttggttttgtcatccgagggggagcgcatgatgacagaaataagtcccgtccagtt
gtgataacctgtgttcgtcctggagggcctgctgacagagagggcaccatcaaacctgga
gacaggttgctcagtgtggatggaattcggcttctgggaaccacccatgctgaggccatg
agcatccttaaacagtgcggacaagaagcaacgctgctgatagaatatgatgtctccgtg
atggattctgtagcaacagcatccgggccactactagttgaagttgccaaaactcccggt
gcaagccttggggttgcactaactacctccgtgtgctgtaacaaacaagtcatcgtcata
gacaaaatcaaatctgcaagcattgcggacaggtgcggggcgctacatgtgggagaccac
atcctctccatcgacggcacgagcatggagtactgtaccctcgcagaagcaacccagttc
ctggccaacaccactgaccaggtcaagctggagattctcccacaccatcagacccgcctg
gccctgaagggacctgaccatgtgaaaattcagaggagcgacagacagcttccctgggat
ccctgggccagcagccagtgcagcgttcataccaaccatcaccataacccgcaccaccca
gaccattgccgagtaccagccctgggttttccgaaagcgcttactccaaacagccctccg
gctatggtgtcctcgtcctctcctacctctatgagtgcgtacagcctgagttccctgaac
atggggactttacctcgaagcctctactctactagtccacgaggaaccatgatgaggagg
agactgaaaaagaaggacttcaaaagctcactgtctttagcttctagcactgtgggattg
gctggacaggttgttcacactgaaaccacagaggttgtgctgacggctgatcctgtcact
ggctttggaatccaactgcagggcagcgtgtttgccacagagactctctcctccccacct
ctgatttcctatattgaagctgacagcccagcagagagatgtggtgtgctgcagattgga
gacagagtcatggccattaatggaatcccaacagaagacagcacctttgaggaagccaat
cagctccttcgagactcttccatcacgagcaaagtcacactggaaatcgagtttgatgtt
gcagaatctgtcatcccaagtagtggaacatttcatgtaaaactgcctaagaagcacagc
gtggagcttggaataaccatcagttcgccatccagtagaaaaccaggggaccctctcgtc
atttcagatatcaagaaaggcagtgtggcacacagaactggaactctggaacttggagat
aaattgctcgccatagataacatccggttggacagctgttccatggaagatgcagtccag
atcctccagcagtgtgaagacctggtgaagctcaaaatccgcaaagatgaagataactca
gatgagcaagagagttccggggcgattatttacacggtggagctgaagcgctatgggggg
ccccttggcatcaccatttctggaacggaagagccctttgatcctattatcatctcgagc
ctcactaaagggggattagctgaaaggactggagcgatccacatcggagatcgaatccta
gccatcaatagcagtagcttgaaggggaagcctctgagtgaagccatccacttgctacag
atggcgggagagactgtcaccctgaaaattaagaagcagacagatgctcaacctgcctca
agtcccaagaagctgcccatccccagccactcaagtgacctaggagatggtgaggaggac
ccctccccaatacaaaggcctggcaagctctctgacgtgtacccctccacagtacccagc
gtggacagtgctgtggactcctgggacggatctggaatagatgccaggtatgggagtcaa
ggcacgacttttcagacttcagggtacaatttcaacacctatgactggaggagtccgaag
aaaagagccagcctgtccccggtccccaagcctcgaagccagacatacccagatgtgggc
ttgagtaatgaagactgggaccggtccacagccagtggcttcgccggggcttctgacagt
gcagacgctgaacaagaggaaaacttctggtctcaagcattggaggacctggagacctgc
ggccagtcgggaatcctgagagagctcgaggcaacaatcatgtcggggagcactatgagt
ttgaatcatgaggctccaacggctcgcagtcagctggggcgacaggccagcttccaggaa
cggagcaattcgaggccacactatagccaaacgactcgcagcaacactctgccctcggat
gtgggcagaaagtctgtgaccctgcggaaaatgaagcaagaaatcaaggagattatgtcc
ccaactcccgtggagcttcacaaggtgaccttatacaaagactctggcatggaggacttt
gggttcagtgtggcagatggcctgctggagaaaggggtgtatgtcaaaaatatccgccca
gctgggccaggtgatcttggaggcttgaagccttatgacaggctcttacaggttaaccac
gtccgaacgagagacttcgactgctgcctggtggtgcccctcatagccgaatccggtaac
aagctggacctggttattagcagaaacccgctggcctcccagaagtcgatagaacagccg
gctctgcccagtgactggagcgaacagaacagcgctttcttccagcagcccagccacggt
ggtaacctagagacacgagaacccactaacacattatag

DBGET integrated database retrieval system