KEGG   Rattus norvegicus (rat): 84017Help
Entry
84017             CDS       T01003                                 

Gene name
Hmga2, Hmgic
Definition
(RefSeq) high mobility group AT-hook 2
  KO
K09283  high mobility group AT-hook protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05202  Transcriptional misregulation in cancer
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    84017 (Hmga2)
   05206 MicroRNAs in cancer
    84017 (Hmga2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    84017 (Hmga2)
   03036 Chromosome and associated proteins [BR:rno03036]
    84017 (Hmga2)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Other transcription factors
   HMGI(Y)
    84017 (Hmga2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    84017 (Hmga2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AT_hook
Motif
Other DBs
NCBI-GeneID: 84017
NCBI-ProteinID: NP_114459
RGD: 620617
Ensembl: ENSRNOG00000042460
UniProt: O88791
Position
7q22
AA seq 107 aa AA seqDB search
MSARGEGAGQPSTSAQGQPATPAPQKRGRGRPRKQPQEPTCEPSPKRPRGRPKGSKNKSP
SKAAQKKAETIGEKRPRGRPRKWPQQIVQKPAQETEETSSQESAEED
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacgcggtgagggcgccgggcagccgtccacatcagcccagggacaacctgcc
accccggcgccacagaagcgaggacgcggccgacccaggaagcagccgcaagagccaacc
tgtgagccctctcctaagagacccagaggaagacccaaaggcagcaagaacaagagcccc
tcgaaagcagctcaaaagaaagcagagaccattggagaaaaacggccaagaggcagaccc
aggaaatggccacaacaaattgttcagaagcctgctcaggagactgaagagacatcctcg
caagagtccgcagaggaagattag

DBGET integrated database retrieval system