KEGG   Rattus norvegicus (rat): 84023
Entry
84023             CDS       T01003                                 

Gene name
Ptger4
Definition
(RefSeq) prostaglandin E2 receptor EP4 subtype
  KO
K04261  prostaglandin E receptor 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04750  Inflammatory mediator regulation of TRP channels
rno04924  Renin secretion
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    84023 (Ptger4)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    84023 (Ptger4)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    84023 (Ptger4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    84023 (Ptger4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    84023 (Ptger4)
   05165 Human papillomavirus infection
    84023 (Ptger4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    84023 (Ptger4)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    84023 (Ptger4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx NdhL Abhydrolase_9_N
Other DBs
NCBI-GeneID: 84023
NCBI-ProteinID: NP_114465
RGD: 628641
Ensembl: ENSRNOG00000013240
UniProt: P43114 A0A0G2JSM6
Position
2
AA seq 488 aa
MSIPGVNASFSSTPERLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGDQALCDYSTFILLFFGLSGLSIICAMSIERYLA
INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGRSERQYPGTWCFIDWTTNVTA
YAAFSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHHAAAAAAVASVA
CRGHAAASPALQRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFINQL
YQPSVVKDISRNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSGRD
GSAQHCSESRRTSSAMSGHSRSFLSRELREISSTSQTLLYLPDLTESSLGGKNLLPGTHG
MGLTQADTTSLRTLRISETSDSSQGQDSESVLLVDEVSGSQREEPASKGNSLQVTFPSET
LKLSEKCI
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgtccatccccggagtcaacgcgtccttctcctccactccggagaggttgaacagccca
gtgaccattcccgcagtgatgtttatcttcggggtggtgggcaacctggtggccatcgta
gtattgtgcaagtcgcgcaaggagcagaaggagactaccttttacactctggtatgtggg
ctggctgtcactgacctactgggcacattgttggtaagcccagtgaccatcgccacatac
atgaagggccagtggcccggagaccaggcattgtgtgactacagcaccttcatcctactt
ttcttcggcctgtcgggtctcagcatcatctgtgccatgagcattgagcgctacctggcc
atcaaccacgcctacttctacagccactacgtggacaagcggctggccggtctcacgctc
ttcgccgtctatgcatctaacgtgctcttctgcgcactgcccaacatgggcctgggtagg
tccgagcggcagtacccggggacctggtgcttcatcgactggaccaccaacgtaacggcc
tacgccgccttctcttacatgtacgcgggcttcagttccttcctcatcctcgccaccgtg
ctctgcaatgtgctggtgtgcggcgcgctgctccgcatgcaccgccagttcatgcgccgc
acctcgctgggcacggagcagcaccacgcggccgctgcagcagcggtggcttcggtggcc
tgtcggggtcacgcggccgcctccccagccctgcagcgcctcagtgactttcgccgccgc
aggagcttccggcgcatcgcgggtgcagagatccagatggtcatcttactcatcgccacc
tctctggtggtgctcatctgctccattccgctcgtggtgcgagtgttcatcaaccagtta
tatcagccaagtgtggtgaaagacatcagcagaaacccggatttgcaggccatcagaatt
gcttctgtgaaccccatcctggacccttggatctacatccttcttcggaagactgtgctc
agtaaagccatagaaaagatcaagtgcctcttctgccgcattggtggttctggcagagac
ggttcagcacagcactgctcagagagtcggaggacatcttctgccatgtctggccactcc
cgctccttcctctcgcgggagttgagggagatcagcagcacctctcagaccctcctatac
ctgccagacctaactgaaagcagcctcggaggcaagaatttgcttccaggtacgcatggc
atgggcctgacccaagcagacaccacctcgctgagaactttgcgaatttcagagacctca
gactcctcccagggccaggactctgagagtgtcttgttggtggatgaggttagtgggagc
cagagagaggagcctgcctctaaggggaactctctgcaagtcacgttccccagtgaaacg
ctgaaattatctgaaaaatgtatatag

DBGET integrated database retrieval system