KEGG   Rattus norvegicus (rat): 84027
Entry
84027             CDS       T01003                                 

Gene name
Gsk3b
Definition
(RefSeq) glycogen synthase kinase 3 beta
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno04012  ErbB signaling pathway
rno04062  Chemokine signaling pathway
rno04110  Cell cycle
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04310  Wnt signaling pathway
rno04340  Hedgehog signaling pathway
rno04360  Axon guidance
rno04390  Hippo signaling pathway
rno04510  Focal adhesion
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04657  IL-17 signaling pathway
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04722  Neurotrophin signaling pathway
rno04728  Dopaminergic synapse
rno04910  Insulin signaling pathway
rno04916  Melanogenesis
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno05010  Alzheimer disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05135  Yersinia infection
rno05160  Hepatitis C
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05200  Pathways in cancer
rno05210  Colorectal cancer
rno05213  Endometrial cancer
rno05215  Prostate cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    84027 (Gsk3b)
   04310 Wnt signaling pathway
    84027 (Gsk3b)
   04340 Hedgehog signaling pathway
    84027 (Gsk3b)
   04390 Hippo signaling pathway
    84027 (Gsk3b)
   04151 PI3K-Akt signaling pathway
    84027 (Gsk3b)
   04150 mTOR signaling pathway
    84027 (Gsk3b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    84027 (Gsk3b)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    84027 (Gsk3b)
   04550 Signaling pathways regulating pluripotency of stem cells
    84027 (Gsk3b)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    84027 (Gsk3b)
   04657 IL-17 signaling pathway
    84027 (Gsk3b)
   04662 B cell receptor signaling pathway
    84027 (Gsk3b)
   04062 Chemokine signaling pathway
    84027 (Gsk3b)
  09152 Endocrine system
   04910 Insulin signaling pathway
    84027 (Gsk3b)
   04917 Prolactin signaling pathway
    84027 (Gsk3b)
   04935 Growth hormone synthesis, secretion and action
    84027 (Gsk3b)
   04919 Thyroid hormone signaling pathway
    84027 (Gsk3b)
   04916 Melanogenesis
    84027 (Gsk3b)
  09156 Nervous system
   04728 Dopaminergic synapse
    84027 (Gsk3b)
   04722 Neurotrophin signaling pathway
    84027 (Gsk3b)
  09158 Development and regeneration
   04360 Axon guidance
    84027 (Gsk3b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    84027 (Gsk3b)
  09162 Cancer: specific types
   05210 Colorectal cancer
    84027 (Gsk3b)
   05225 Hepatocellular carcinoma
    84027 (Gsk3b)
   05226 Gastric cancer
    84027 (Gsk3b)
   05217 Basal cell carcinoma
    84027 (Gsk3b)
   05215 Prostate cancer
    84027 (Gsk3b)
   05213 Endometrial cancer
    84027 (Gsk3b)
   05224 Breast cancer
    84027 (Gsk3b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    84027 (Gsk3b)
   05020 Prion disease
    84027 (Gsk3b)
   05022 Pathways of neurodegeneration - multiple diseases
    84027 (Gsk3b)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    84027 (Gsk3b)
   04931 Insulin resistance
    84027 (Gsk3b)
   04934 Cushing syndrome
    84027 (Gsk3b)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    84027 (Gsk3b)
  09172 Infectious disease: viral
   05160 Hepatitis C
    84027 (Gsk3b)
   05162 Measles
    84027 (Gsk3b)
   05163 Human cytomegalovirus infection
    84027 (Gsk3b)
   05167 Kaposi sarcoma-associated herpesvirus infection
    84027 (Gsk3b)
   05165 Human papillomavirus infection
    84027 (Gsk3b)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    84027 (Gsk3b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    84027 (Gsk3b)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    84027 (Gsk3b)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     84027 (Gsk3b)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   84027 (Gsk3b)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    84027 (Gsk3b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 84027
NCBI-ProteinID: NP_114469
RGD: 70982
Ensembl: ENSRNOG00000002833
UniProt: P18266 A0A0G2JSH4
Position
11q21
AA seq 420 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgtcggggcgaccgagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggtagcatgaaagttagcagagataaagatggcagcaaggtaaccacagtg
gtggcaactcctggacagggtcctgacaggccacaggaagtcagttacacagacactaaa
gtcattggaaatgggtcatttggtgtggtatatcaagccaaactttgtgactcaggagaa
ctggtggccatcaagaaagttcttcaggacaagcgatttaagaaccgagagctccagatc
atgagaaagctagatcactgtaacatagtccgattgcggtatttcttctactcgagtggc
gagaagaaagatgaggtctaccttaacctggtgctggactatgttccggaaacagtgtac
agagtcgccagacactatagtcgagccaagcagacactccctgtgatctatgtcaagttg
tatatgtaccagctgttcagaagtctagcctatatccattcctttgggatctgccatcga
gacattaaaccacagaacctcttgctggatcctgatacagctgtattaaaactctgcgac
tttggaagtgcaaagcagctggtccgaggagagcccaatgtttcatatatctgttctcgg
tactacagggcaccagagctgatctttggagccaccgattacacgtctagtatagatgta
tggtctgcaggctgtgtgttggctgaattgttgctaggacaaccaatatttcctggggac
agtggtgtggatcagttggtggaaataataaaggtcctaggaacaccaacaagggagcaa
attagagaaatgaacccaaattatacagaattcaaattcccccaaatcaaggcacatcct
tggacgaaggtctttcggccccgaactccaccagaggcaatcgcactgtgtagccgtctc
ctggagtacacgccgaccgcccggctaacaccactggaagcttgtgcacattcatttttt
gatgaattacgggacccaaatgtcaaactaccaaatgggcgagacacacctgccctcttc
aactttaccactcaagaactgtcaagtaacccacctctggccaccatccttatccctcct
cacgctcggattcaggcagctgcttcaccgcctgcaaacgccacagcagcctcagatact
aatgctggagaccgtggacagaccaataacgccgcttctgcatcagcctccaactctacc
tga

DBGET integrated database retrieval system