KEGG   Rattus norvegicus (rat): 84046
Entry
84046             CDS       T01003                                 

Gene name
Sox11
Definition
(RefSeq) SRY box 11
  KO
K09268  transcription factor SOX11/12 (SOX group C)
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    84046 (Sox11)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    84046 (Sox11)
SSDB
Motif
Pfam: HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 84046
NCBI-ProteinID: NP_445801
RGD: 69351
Ensembl: ENSRNOG00000030034
UniProt: P0C1G9
Position
6q16
AA seq 395 aa
MVQQAESSEAESNLPRDALDTEEGEFMACSPVALDESDPDWCKTASGHIKRPMNAFMVWS
KIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRP
RKKPKTDPAAKPSAGQSPDKSAAGAKAAKGPGKKCAKLKAPAGKAGAGKAAQPGDCGAGK
AAKCVFLDDDDEEDDEDDELQLRPKPDADDDDDEPAHSHLLPPPAQQQPPQLLRRYSVAK
VPASPTLSSAAESPEGASLYDEVRAGGRLYYSFKNITKQQPPPAPPALSPASSRCVSTSS
SSGSSSGSGAEDADDLMFDLSLNFSQGAHSACEQPLGAGAAGNLSLSLVDKDLDSFSEGS
LGSHFEFPDYCTPELSEMIAGDWLEANFSDLVFTY
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggtgcagcaggccgagagctcggaagccgagagcaacctgccccgggacgcgctggac
accgaggagggcgagttcatggcgtgcagcccggtggccctggatgagagcgacccggac
tggtgcaagacggcgtcgggccacatcaaacggcccatgaacgccttcatggtgtggtcc
aagatcgagcgcaggaagatcatggagcagtcgcccgacatgcataacgccgagatctcc
aagaggctgggcaagcgttggaagatgctgaaggacagcgagaagatcccgttcatccgg
gaggcggagcgcctgcgcctcaagcacatggctgattatcccgactacaagtaccggccg
cgcaaaaagcccaagacggacccagccgccaagcccagcgcgggccagagcccggacaag
agcgcggcgggcgctaaggcagccaagggcccgggcaagaagtgcgccaagctcaaggcg
cctgcgggcaaggcgggcgcaggcaaggcggcgcagcctggggactgcggcgcgggcaag
gcagccaagtgcgtcttcctggacgacgatgatgaagaggacgacgaggacgacgagctg
cagctacggcccaagccggacgcagacgacgacgacgacgagcccgcgcactcgcacctg
ctgccgccaccggcgcagcagcagccccctcagctgctgaggcgctacagcgtggccaag
gtgcccgccagccccacgctcagcagtgccgccgagtcccccgagggcgcgagcctttac
gacgaagtgcgcgcgggcggccggctctactacagcttcaagaacatcaccaagcagcag
cctccgcccgcgcctcccgcgctgtcgcccgcgtcctcgcgctgcgtgtccacctcctca
tccagcggcagcagcagcggcagcggcgccgaggatgccgacgacctcatgttcgacctg
agcttgaatttctcccagggcgcgcacagcgcctgcgagcagccactgggcgcgggagcg
gcggggaacctgtccctgtcgctggtggataaggacctggattccttcagcgagggcagc
ctgggctcccacttcgagttccccgactactgcacgccggagctgagcgagatgatcgcg
ggggactggctggaggcgaacttctccgacctggtgttcacgtattga

DBGET integrated database retrieval system