KEGG   Rattus norvegicus (rat): 84347
Entry
84347             CDS       T01003                                 

Gene name
Cacng2, Ipr328
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 2
  KO
K04867  voltage-dependent calcium channel gamma-2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04921  Oxytocin signaling pathway
rno05410  Hypertrophic cardiomyopathy
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    84347 (Cacng2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    84347 (Cacng2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    84347 (Cacng2)
   04261 Adrenergic signaling in cardiomyocytes
    84347 (Cacng2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    84347 (Cacng2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    84347 (Cacng2)
   05414 Dilated cardiomyopathy
    84347 (Cacng2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    84347 (Cacng2)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   84347 (Cacng2)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 84347
NCBI-ProteinID: NP_445803
RGD: 71095
Ensembl: ENSRNOG00000006226
UniProt: Q99PR9
Structure
PDB: 

Position
7q34
AA seq 323 aa
MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTH
SGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGL
CIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSF
YFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRYQRRSRSS
SRSTEPSHSRDASPVGVKGFNTLPSTEISMYTLSRDPLKAATTPIATYNSDRDNSFLQVH
NCIQKDSKDSLHANTANRRTTPV
NT seq 972 nt   +upstreamnt  +downstreamnt
atggggctgtttgatcgaggtgttcaaatgcttttaaccaccgttggtgctttcgctgcc
ttcagcttgatgaccatcgctgtgggaaccgactattggctgtactccagaggggtttgc
aagaccaaaagtgtcagtgagaatgaaaccagcaaaaagaacgaggaagttatgacccat
tccggattatggagaacctgctgcctcgaagggaacttcaaaggtctgtgcaagcaaatc
gaccactttcccgaagacgcggactacgaggctgacaccgcagagtatttcctcagggcc
gtgagggcctcgagtatcttcccaatcctgagtgtgatcctgctcttcatgggtggtctc
tgcatcgctgcaagcgagttttacaagacacgtcacaacatcatcctgagcgctggcatc
ttcttcgtgtctgcaggtctaagtaatattatcgggatcatcgtgtatatatcagccaat
gctggagacccctccaagagtgactccaaaaagaacagctactcctacggctggtccttc
tacttcggggccctgtccttcatcatcgccgagatggtcggggtgctggccgtgcacatg
tttatcgaccgccacaaacagctgcgggccacggcccgtgccaccgactacctccaggcc
tccgccatcacccgcatccccagctaccgctaccgctaccagcgccgcagccgctccagc
tcgcgctccaccgagccctctcactccagggacgcctcgcccgtgggcgtgaagggcttc
aacaccctgccgtccacggagatctccatgtacaccctcagtagggaccccctgaaggct
gccaccacgcccatcgccacctacaactcggacagggataacagctttctccaggtccac
aactgtatccagaaggacagcaaggactctctccacgccaacacagccaaccgccggacc
acgcccgtatga

DBGET integrated database retrieval system