KEGG   Rattus norvegicus (rat): 84348
Entry
84348             CDS       T01003                                 

Gene name
Ackr3, Cmkor1, Cxcr7, Rdc1
Definition
(RefSeq) atypical chemokine receptor 3
  KO
K04304  C-X-C chemokine receptor type 7 (atypical chemokine receptor 3)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    84348 (Ackr3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    84348 (Ackr3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    84348 (Ackr3)
   04050 Cytokine receptors [BR:rno04050]
    84348 (Ackr3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    84348 (Ackr3)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CXC Chemokine
   84348 (Ackr3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 84348
NCBI-ProteinID: NP_445804
RGD: 620601
Ensembl: ENSRNOG00000019622
UniProt: O89039
Position
9q36
AA seq 362 aa
MDVHLFDYVEPGNYSDINWPCNSSDCIVVDTVQCPAMPNKNVLLYTLSFIYIFIFVIGMI
ANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVITIPVWVVSLVQHNQWPMGELTCKIT
HLIFSINLFGSIFFLACMSVDRYLSITYFTSTSSYKKKMVRRVVCVLVWLLAFFVSLPDT
YYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVILGFAVPFTIIAIFYFLLARAMS
ASGDQEKHSSRKIIFSYVVVFLVCWLPYHFVVLLDIFSILHYIPFTCQLENVLFTALHVT
QCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQN
TK
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggatgtgcatctgtttgactatgtggaacctgggaactactcggacatcaactggccc
tgtaacagtagcgactgcatcgtcgtggacaccgtgcagtgtcccgccatgcccaacaag
aatgtgctgctgtataccctctccttcatctacattttcatcttcgtgatcggtatgatt
gccaactccgtggtggtctgggtgaatatccaggccaagactacaggctacgacacacac
tgctacatcttgaacctggccattgccgatctgtgggtcgtcatcaccatccctgtctgg
gtggtcagtctcgtgcagcataaccagtggcccatgggtgagctcacgtgcaagatcaca
cacctcattttctccatcaacctctttgggagcatcttcttcctcgcatgcatgagcgtg
gaccgctatctctccatcacctacttcaccagcacctccagctataagaagaagatggta
cgccgtgttgtctgcgtcttggtgtggctgctggccttctttgtgtccctgcctgacacc
tactacctgaagacggtcacatctgcttccaacaacgagacctactgcaggtccttctac
cccgagcacagcatcaaggagtggctcattggcatggagctggtctccgtcatcttgggt
tttgctgtccccttcaccatcattgctatcttctacttcctgctcgccagagccatgtca
gcatccggtgaccaggagaaacacagcagccggaagatcatcttctcctacgtggtggtc
ttcctggtgtgttggctgccgtaccattttgtggttctgctggacatcttctctatcttg
cactacatcccgttcacctgccaactggagaatgtgctctttacagcgctgcacgtcacg
cagtgcctgtccctggtgcactgctgtgtcaaccctgtgctctacagcttcatcaaccga
aactacaggtacgagctgatgaaggccttcatcttcaagtactcagccaaaacaggactc
accaaactcatcgatgcctccagagtgtcagagacagagtactctgccctggagcagaac
accaagtga

DBGET integrated database retrieval system