KEGG   Rattus norvegicus (rat): 84349
Entry
84349             CDS       T01003                                 

Gene name
Cd40lg
Definition
(RefSeq) CD40 ligand
  KO
K03161  tumor necrosis factor ligand superfamily member 5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04064  NF-kappa B signaling pathway
rno04514  Cell adhesion molecules
rno04660  T cell receptor signaling pathway
rno04672  Intestinal immune network for IgA production
rno05144  Malaria
rno05145  Toxoplasmosis
rno05310  Asthma
rno05320  Autoimmune thyroid disease
rno05322  Systemic lupus erythematosus
rno05330  Allograft rejection
rno05340  Primary immunodeficiency
rno05416  Viral myocarditis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    84349 (Cd40lg)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    84349 (Cd40lg)
   04514 Cell adhesion molecules
    84349 (Cd40lg)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    84349 (Cd40lg)
   04672 Intestinal immune network for IgA production
    84349 (Cd40lg)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    84349 (Cd40lg)
   05145 Toxoplasmosis
    84349 (Cd40lg)
  09163 Immune disease
   05310 Asthma
    84349 (Cd40lg)
   05322 Systemic lupus erythematosus
    84349 (Cd40lg)
   05320 Autoimmune thyroid disease
    84349 (Cd40lg)
   05330 Allograft rejection
    84349 (Cd40lg)
   05340 Primary immunodeficiency
    84349 (Cd40lg)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    84349 (Cd40lg)
   05416 Viral myocarditis
    84349 (Cd40lg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    84349 (Cd40lg)
   04090 CD molecules [BR:rno04090]
    84349 (Cd40lg)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Tumor necrosis fators
   84349 (Cd40lg)
CD molecules [BR:rno04090]
 Proteins
  84349 (Cd40lg)
SSDB
Motif
Pfam: TNF DUF5919
Other DBs
NCBI-GeneID: 84349
NCBI-ProteinID: NP_445805
RGD: 708418
Ensembl: ENSRNOG00000000871
UniProt: Q9Z2V2
Position
X
AA seq 260 aa
MIETYSQPSPRSVATGLPASMKIFMYLLTVFLITQMIGSVPFAVYLHRRLDKVEEEASLH
EDFVFVKKLKRCNKGEGSLSLLNCEEMRRQFEDLVKDISLNKEEKKEKSFEMQRGDEDPQ
IAAHVVSEANSNAASVLQWAKKGYYTMKSNLVVLENGRQLTVKREGLYYVYTQVTFCSNR
EPLSQRPFIVSLWLKPSSGSERILLRAANTHSSSKLCEQQSIHLGGVFELQAGASVFVNV
TEASQVIHGIGFSSIGLLKL
NT seq 783 nt   +upstreamnt  +downstreamnt
atgatagaaacatacagccaaccttctcccagatctgtggctactgggcttccagcgagc
atgaagatttttatgtatttacttactgtttttcttatcacccagatgattgggtcggtg
ccttttgctgtgtatcttcatagaagattggataaggtagaggaggaagcaagccttcac
gaggattttgtattcgtaaaaaagctaaagaggtgcaacaaaggagaagggtccttatcc
ttgctcaactgtgaggagatgagaaggcaatttgaagaccttgtcaaggatatatcgtta
aacaaagaagagaaaaaagaaaagagctttgaaatgcaaagaggtgatgaggatcctcaa
attgcagcacatgttgtaagtgaggccaacagtaatgcagcatctgttcttcagtgggcg
aagaaaggatattataccatgaaaagcaacttggtagtgctggaaaatgggagacaactg
acggttaaaagagaaggactctattatgtctacacccaagtcaccttctgctctaatcgg
gaacctttgagtcaacgtccattcatcgtcagcctctggctgaagcccagcagtgggtca
gagagaatcttactcagggcagcgaatacccacagttcctccaagctttgtgagcaacag
tccattcacttgggcggagtatttgaattacaagcaggtgcttctgtgtttgtcaacgtg
actgaagcaagccaagtgatccacggaattggcttctcatctattggcttactcaaactc
tga

DBGET integrated database retrieval system