KEGG   Rattus norvegicus (rat): 84353
Entry
84353             CDS       T01003                                 

Gene name
Ctnnb1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04510  Focal adhesion
rno04520  Adherens junction
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04670  Leukocyte transendothelial migration
rno04916  Melanogenesis
rno04919  Thyroid hormone signaling pathway
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05100  Bacterial invasion of epithelial cells
rno05132  Salmonella infection
rno05160  Hepatitis C
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05210  Colorectal cancer
rno05213  Endometrial cancer
rno05215  Prostate cancer
rno05216  Thyroid cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05412  Arrhythmogenic right ventricular cardiomyopathy
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    84353 (Ctnnb1)
   04310 Wnt signaling pathway
    84353 (Ctnnb1)
   04390 Hippo signaling pathway
    84353 (Ctnnb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    84353 (Ctnnb1)
   04520 Adherens junction
    84353 (Ctnnb1)
   04550 Signaling pathways regulating pluripotency of stem cells
    84353 (Ctnnb1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    84353 (Ctnnb1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    84353 (Ctnnb1)
   04916 Melanogenesis
    84353 (Ctnnb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    84353 (Ctnnb1)
   05205 Proteoglycans in cancer
    84353 (Ctnnb1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    84353 (Ctnnb1)
   05225 Hepatocellular carcinoma
    84353 (Ctnnb1)
   05226 Gastric cancer
    84353 (Ctnnb1)
   05216 Thyroid cancer
    84353 (Ctnnb1)
   05217 Basal cell carcinoma
    84353 (Ctnnb1)
   05215 Prostate cancer
    84353 (Ctnnb1)
   05213 Endometrial cancer
    84353 (Ctnnb1)
   05224 Breast cancer
    84353 (Ctnnb1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    84353 (Ctnnb1)
   05163 Human cytomegalovirus infection
    84353 (Ctnnb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    84353 (Ctnnb1)
   05165 Human papillomavirus infection
    84353 (Ctnnb1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    84353 (Ctnnb1)
   05100 Bacterial invasion of epithelial cells
    84353 (Ctnnb1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    84353 (Ctnnb1)
   05022 Pathways of neurodegeneration - multiple diseases
    84353 (Ctnnb1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    84353 (Ctnnb1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    84353 (Ctnnb1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    84353 (Ctnnb1)
SSDB
Motif
Pfam: Arm Cnd1 HEAT_2 Adaptin_N KAP Arm_2 Atx10homo_assoc Queuosine_synth
Other DBs
NCBI-GeneID: 84353
NCBI-ProteinID: NP_445809
RGD: 70487
Ensembl: ENSRNOG00000054172
UniProt: Q9WU82
Position
8
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGPHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEALGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctactcaagctgacctcatggagttggacatggccatggagccagacagaaaggcc
gctgtcagccactggcagcagcaatcttacctggattctggaatccactctggtgccacc
accacagctccttccctgagtggcaagggcaatcctgaggaagaagatgtggacacctcc
caagtcctttatgagtgggagcaaggcttttcccagtccttcacgcaagagcaagtagct
gacattgacggtcagtacgccatgactcgggctcagagggtccgagctgccatgttccct
gagacactagatgagggcatgcagatcccatccacgcagtttgatgccgctcatcccact
aatgtccagcgcttggctgaaccgtcacagatgctgaaacatgcagttgtcaatttgatt
aactatcaggatgacgcggaacttgccacccgtgcaattcctgagctgaccaaactgcta
aatgacgaggaccaggtggtcgttaataaagctgctgttatggttcaccagctttccaaa
aaggaagcttccagacacgccatcatgcgctcccctcagatggtgtctgccatagtgcgc
accatgcagaatacaaatgacgtagaaacagcccgttgtaccgctgggaccctacacaac
ctttcccaccatcgagagggcttgttggccatctttaaatctggcggcatcccagcgctg
gtgaaaatgcttgggtcgccagtggattccgtactgttctacgccatcaccacgctgcat
aatctcctgctacatcaggaaggagctaaaatggcagtgcgcctagctggtgggctgcag
aaaatggttgctttgctcaacaaaacaaacgtgaagttcttggctattacgacagactgc
cttcagatcttagcttacggcaatcaggaaagcaagctcatcattctggccagtggtgga
ccccaagccttagtaaacataatgagaacctacacgtacgagaagctcctgtggaccaca
agcagagtgctgaaggtgctgtctgtctgctctagcaacaagccggccatcgtggaagct
ggtgggatgcaggcactggggcctcacctgacagacccgagtcagcgacttgttcaaaac
tgtctttggactctgagaaacttgtccgatgcagcgactaagcaggaagggatggaaggc
ctccttgggactctagtgcagcttctgggttctgatgatataaatgtggtcacctgcgca
gctggaattctctctaacctcacttgcaataattacaaaaacaagatgatggtgtgccaa
gtgggtggcatagaggctcttgtgcgcactgtccttcgtgctggtgacagggaggacatt
accgagcctgccatctgtgctcttcgtcatctgaccagccgacatcaggaagctgagatg
gcccagaatgccgttcgccttcattatggactacctgttgtggttaaactcctgcaccca
ccatcccactggcctctgataaaggcaactgttggattgatccgaaaccttgccctttgc
ccagcaaatcatgcgcctttgcgggaacagggtgcgatcccacgactagttcagctgctt
gtacgagcacatcaggacacccagcggcgcacgtccatgggtggaacacagcagcagttc
gtggagggcgtccgcatggaggagatagttgaagggtgcactggggctctccacatcctc
gctcgggatgttcacaaccggattgtgatccgaggactcaataccattccactgtttgtg
cagttgctttattctcccattgaaaatatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaggctgcagaggccattgaggctgagggagccacagctcccctg
acagagttgctccactccaggaatgaaggcgtggcaacatatgcggctgctgttctattc
cgaatgtctgaggacaagccacaggactacaagaaacggctttcggttgagctgaccagt
tccctcttcaggacagagccaatggcttggaatgagactgctgatctcggactggacatt
ggtgcccagggagaagcccttggatatcgccaggacgatcccagctaccgttcttttcac
tctggtggatacggccaggacgccttggggatggaccctatgatggagcatgagatgggt
ggccaccaccctggtgctgactatccagttgatgggctgcctgacctgggacacgcccag
gacctcatggacgggctgcctccaggtgatagcaatcagctggcctggtttgataccgac
ctgtaa

DBGET integrated database retrieval system