KEGG   Rattus norvegicus (rat): 84356Help
Entry
84356             CDS       T01003                                 

Gene name
Abcd2, ALDR
Definition
(RefSeq) ATP binding cassette subfamily D member 2
  KO
K05676  ATP-binding cassette, subfamily D (ALD), member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno02010  ABC transporters
rno04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    84356 (Abcd2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    84356 (Abcd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    84356 (Abcd2)
Transporters [BR:rno02000]
 ABC Transporters, Eukaryotic Type
  ABCD (ALD) subfamily
   ABCD2 subgroup
    84356 (Abcd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane_2 ABC_tran AAA_21 AAA_23 Rad17 AAA_29 RVP Adeno_IVa2 SMC_N ARID AAA_27
Motif
Other DBs
NCBI-GeneID: 84356
NCBI-ProteinID: NP_203503
RGD: 69244
Ensembl: ENSRNOG00000015538
UniProt: Q9QY44
Position
7q35
AA seq 741 aa AA seqDB search
MIHMLNAAAYRVKWTRSGAAKRAACLVAAAYALKTLYPILGRRLKQPGHRKAKAEDYPPA
ENRERLHCTEIICKKPAPGLNADFFKQLLELRKILFPKLVTTETGWLCLHSVALISRTFL
SIYVAGLDGKIVKSIVEKKPRTFIIKLVKWLMIAVPATFVNSAIRYLECKLALAFRTRLV
DHAYETYFANQTYYKVINMDGRLANPDQSLTEDIMMFSQSVAHLYSNLTKPILDVILTSY
TLIRTATSRGASPIGPTLLAGLVVYATAKVLKACSPKFGTLVAEEAHRKGYLRYVHSRII
ANVEEIAFYRGHKVEMKQLQKCYKALAYQMNLILSKRLWYIMIEQFLMKYVWSGCGLIMV
AIPIITATGFADGDLEDGPKQAMVSDRTEAFTTARNLLASGADAIERIMSSYKEITELAG
YTARVYNMFWVFDEVKRGIYKRTVTQEPENNSKSGGGLELPLSDTLAIKGTVIDVDHGIL
CENVPIITPAGEVVASSLNFKVEEGMHLLITGPNGCGKSSLFRILSGLWPVYEGVLYKPP
PQHMFYIPQRPYMSLGSLRDQVIYPDSVDDMHEKGYTDRDLEHILHSVHLYHIVQREGGW
DAVMDWKDVLSGGEKQRMGMARMFYHKPKYALLDECTSAVSIDVEGKIFQAAIGAGISLL
SITHRPSLWKYHTHLLQFDGEGGWRFEQLDTAIRLTLSEEKQKLESQLAGIPKMQQRLNE
LCKILGEDSVLKTIQTAEDTS
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgatacacatgctaaatgcagcagcctatcgggtgaaatggaccagatccggtgctgct
aaaagggctgcctgcctggtggctgcggcatatgctctgaaaaccctctatcccatcctt
ggcaggcgtttaaagcagcctggccaccggaaggcgaaagcagaagattacccgcctgca
gagaacagagaaagactgcattgcacagagatcatctgtaaaaaacctgcgccgggacta
aatgcagattttttcaaacagctactagaacttcggaaaatcctctttccaaaacttgtg
accactgaaacggggtggctctgcctccactcggtggctctaatctcacgaacgtttctg
tctatctacgtggctggtctggatgggaaaatcgtgaaaagcatcgtggaaaagaagcct
cggactttcatcatcaaactagtcaagtggcttatgattgccgtccccgctacctttgtc
aacagcgctatcaggtacctggagtgcaaactggcattggcctttagaactcgcttagtg
gaccatgcctatgagacctattttgcaaatcagacttattataaggtgataaatatggac
gggaggctggcaaaccctgaccagtctcttactgaagacattatgatgttctcgcaatcg
gtggctcacctgtattccaaccttaccaaaccgattttagatgtaattctaacctcctat
accctcatccggacagctacatccagaggagcaagccccatcgggcccaccctgttagca
gggctcgtggtgtatgccactgctaaagtcctgaaagcttgctcgcccaaatttggtact
ctggtggctgaagaagctcatagaaagggctacttgcggtatgttcactccagaatcata
gccaatgtggaagaaattgccttctacagaggacataaggtagaaatgaagcaactgcag
aagtgttacaaggctttagcttaccagatgaaccttattctatccaaacgtttgtggtac
atcatgatagaacagttcctgatgaagtatgtgtggagcggctgtggactaattatggtg
gccatacctatcatcactgcaacaggctttgcagatggtgatctggaggatggccctaag
caggctatggttagcgatcggacagaggcctttaccactgctcggaatttactggcctct
ggagctgacgcgattgagaggattatgtcttcatacaaagagatcactgaactagcgggt
tatactgccagagtgtacaacatgttctgggtcttcgatgaagtgaagagaggcatttat
aagagaactgtcactcaggagcctgaaaacaatagcaagagtggaggtggcctggagctg
cccctcagtgacaccctggcaatcaaagggacagtcattgacgtggatcatggaatcctt
tgtgaaaatgttcccataatcacgccggcgggagaagtggtggcttccagtctgaacttc
aaagtagaagaagggatgcatcttttgataaccggccccaatggttgtgggaaaagctct
ctgttcagaatcttaagtgggctctggcctgtgtatgaaggagtcctttataaaccacct
ccccaacatatgttctatattccacagaggccgtacatgtctcttggaagtcttcgggat
caagtcatttatcctgactcggtggatgacatgcatgagaaaggttatacagaccgagac
ctagagcatattctgcacagcgtccacctctaccacatagtccaaagagaaggaggatgg
gatgcagtcatggattggaaagatgtcctttcaggaggggagaaacagagaatggggatg
gcacggatgttttaccataaaccgaagtacgcattgctggacgagtgcaccagtgctgtg
agcattgacgtggaaggaaagatatttcaggctgctatcggggctggcatttccttactg
tctataacgcacaggccttctctgtggaaataccacacccacctattgcaatttgatggc
gaaggaggttggcgctttgaacagttggacactgctatccgcttaacgttaagcgaggag
aaacagaagttggagtcgcagctcgctggaattcccaaaatgcagcagagactcaatgaa
ctgtgcaaaattttgggggaagactcggtgctgaaaacgatccaaactgcagaggacaca
tcctaa

DBGET integrated database retrieval system