KEGG   Rattus norvegicus (rat): 84357Help
Entry
84357             CDS       T01003                                 

Gene name
Sh3kbp1, CIN85, Seta
Definition
(RefSeq) SH3 domain-containing kinase-binding protein 1
  KO
K12470  SH3 domain-containing kinase-binding protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    84357 (Sh3kbp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    84357 (Sh3kbp1)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    84357 (Sh3kbp1)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    84357 (Sh3kbp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_9 SH3_1 SH3_2 Tmemb_cc2
Motif
Other DBs
NCBI-GeneID: 84357
NCBI-ProteinID: NP_445812
RGD: 620904
Ensembl: ENSRNOG00000004322
UniProt: Q925Q9 Q6IRL5
Position
Xq14
AA seq 665 aa AA seqDB search
MVEAIVEFDYQAQHDDELTISVGEVITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKDV
KKDLLSNKAPEKPMHDVSSGNSLLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELK
VGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTG
SESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEVENDFLPV
EKTIGKKLPPATSTPDPSKTEMDSRTKTKDYCKVIFPYEAQNDDELTIKEGDIVTLINKD
CIDVGWWEGELNGRRGVFPDNFVKLLPSDFDKEGNRPKKPPPPSAPVIKQGAGTTERKHE
IKKIPPERPETLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLNRPGVLPPR
RPERPVGPLTHTRGDSSKIDLAGSTLSGILDKDLSDRSNDIDLEGFDSVISSTEKLSHPT
TSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGIDVSKKTSRTVTIS
QVSDNKASLPPKPGTMAAASSGPASLSSVASSPMSSSLGTAGQRASSPSLFSAEGKAKTE
SAVSSQAAIEELKMQVRELRTIIETMKDQQKREIKQLLSELDEEKKIRLRLQMEVNDIKK
ALQSK
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggtggaggccatagtggagtttgattaccaggcccagcatgatgatgagctgacgatc
agcgtgggtgaggtcatcaccaacatcaggaaggaggatggaggctggtgggagggacag
atcaacggcaggagaggtttgttccctgacaactttgtaagagaaataaagaaggatgtg
aagaaagaccttctctctaacaaagctcctgagaagcccatgcatgatgtgtccagtgga
aactctttgctttcttctgaaaccattttaagaaccaataaacgaggagagcgacggaga
cgccgatgccaggtggcgttcagctacctgcctcagaatgacgatgagcttgagctgaaa
gtcggggacatcatagaggttgtaggagaggtggaggaaggatggtgggaaggcgtactc
aatgggaagactggaatgtttccttccaacttcatcaaggagctgtcaggggagtcggat
gagcttggcatttcccaggatgagcagctttccaagtcaagcttaagagaaaccacaggc
tccgagagtgatggaggcgactcaagcagtaccaagtctgaaggcgccaatgggacggtg
gcaactgcagctatccagcccaagaaagttaaaggagtggggtttggagatattttcaaa
gacaagccaattaaactaagaccaaggtcgattgaagtggaaaatgacttcctgcctgta
gaaaagacaattgggaagaagttacctccagctacatcaaccccagacccatcgaaaaca
gaaatggacagcaggacaaagaccaaggattactgcaaagtaatatttccatatgaggca
cagaatgatgacgaattgacaatcaaggaaggagatatagtgactctcatcaataaggac
tgcatcgatgtaggctggtgggaaggagagctcaatggcagacgaggagtgtttcctgac
aacttcgtgaagttacttccgtcagacttcgacaaggaagggaatagacccaagaagccg
ccacctccatccgctcctgtcatcaaacaaggggcaggtaccacagagagaaaacatgaa
attaaaaagatacctcctgaaagaccggaaacacttccaaacagaacagaagagaaagaa
agaccagagagagagccaaaactggatttacagaagccttctgttcctgccatcccacct
aaaaagcctcgtccacctaagaccaattctctgaacagacccggtgtgttgcccccaaga
agacccgagcgaccagtgggcccactgacacacaccaggggtgacagttcaaagattgac
ttggcaggcagcacgctctctggcatcttggataaggacctctcagaccgcagcaatgat
attgacctagaaggttttgactccgtgatatcatctactgaaaaactcagccacccaacc
acaagcagaccaaaagctacgggaagacggcctccttctcagtcgctcacatcttcttcc
ctttcaagccctgatatctttgactccccaagtcccgaagaagataaagaggaacacatt
tcgcttgcgcacagaggaatagacgtgtcaaagaagacttccagaactgttaccatatcc
caagtgtctgataacaaggcttccctgccacccaagccagggaccatggcagctgccagc
agtgggccagcctctctctcttcagtggcttcctctcccatgtcatcctctttgggaaca
gctggacaacgagccagttctccatctctgttcagcgcagaaggaaaagcaaagacggag
tctgcagtgagcagccaggctgccatcgaggagctcaagatgcaagtccgtgagctgaga
accatcatcgagaccatgaaggaccagcagaaacgtgagattaagcagttactgtcagaa
ttggatgaagagaaaaagatccggctccgattgcagatggaggtgaatgacataaagaaa
gctctccaatcaaaatga

DBGET integrated database retrieval system