KEGG   Rattus norvegicus (rat): 84360Help
Entry
84360             CDS       T01003                                 

Gene name
Clcn3, ClC-3
Definition
(RefSeq) chloride voltage-gated channel 3
  KO
K05012  chloride channel 3/4/5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    84360 (Clcn3)
Ion channels [BR:rno04040]
 Chloride channels
  Chloride channel (CLC)
   84360 (Clcn3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Voltage_CLC CBS
Motif
Other DBs
NCBI-GeneID: 84360
NCBI-ProteinID: NP_445815
RGD: 621219
Ensembl: ENSRNOG00000010682
UniProt: P51792
Position
16p12
AA seq 818 aa AA seqDB search
MESEQLFHRGYYRNSYNSITSASSDEELLDGAGAIMDFQTSEDDNLLDGDTAAGTHYTMT
NGGSINSSTHLLDLLDEPIPGVGTYDDFHTIDWVREKCKDRERHRRINSKKKESAWEMTK
SLYDAWSGWLVVTLTGLASGALAGLIDIAADWMTDLKEGICLSALWYNHEQCCWGSNETT
FEERDKCPQWKTWAELIIGQAEGPGSYIMNYIMYIFWALSFAFLAVSLVKVFAPYACGSG
IPEIKTILSGFIIRGYLGKWTLMIKTITLVLAVASGLSLGKEGPLVHVACCCGNIFSYLF
PKYSTNEAKKREVLSAASAAGVSVAFGAPIGGVLFSLEEVSYYFPLKTLWRSFFAALVAA
FVLRSINPFGNSRLVLFYVEYHTPWYLFELFPFILLGVFGGLWGAFFIRANIAWCRRRKS
TKFGKYPVLEVIIVAAITAVIAFPNPYTRLNTSELIKELFTDCGPLESSSLCDYRNDMNA
SKIVDDIPDRPAGVGVYSAIWQLCLALIFKIIMTVFTFGIKVPSGLFIPSMAIGAIAGRI
VGIAVEQLAYYHHDWFIFKEWCEVGADCITPGLYAMVGAAACLGGVTRMTVSLVVIVFEL
TGGLEYIVPLMAAVMTSKWVGDAFGREGIYEAHIRLNGYPFLDAKEEFTHTTLAADVMRP
RRSDPPLAVLTQDNMTVDDIENMINETSYNGFPVIMSKESQRLVGFALRRDLTIAIESAR
KKQEGVVGSSRVCFAQHTPSLPAESPRPLKLRSILDMSPFTVTDHTPMEIVVDIFRKLGL
RQCLVTHNGRLLGIITKKDILRHMAQTANQDPASIMFN
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atggagtctgagcagctgttccatagaggctactatagaaacagctacaacagcataacg
agcgcgagtagcgatgaggagctcctagatggagcaggtgctattatggactttcagact
tccgaagacgacaatttgttagacggtgacacagcagctggaactcattatacaatgaca
aatggaggcagcattaacagctccacacacttgctggatcttttggatgagcccatccca
ggtgtcggtacatacgatgatttccatactattgactgggtgcgagaaaagtgtaaggac
agagaaaggcacagacggatcaacagtaaaaaaaaagaatcagcatgggaaatgacaaaa
agtctatatgatgcttggtcaggatggcttgtagttacactgacgggattggcgtcaggg
gcgctggctggattgatagacattgctgctgactggatgactgacctgaaagagggcatc
tgcctcagtgcattgtggtacaaccatgaacagtgttgttggggctctaatgagacgacg
tttgaagagagggataaatgtccacagtggaaaacatgggcagagttaatcataggtcaa
gcagagggtcctggatcttatatcatgaactacatcatgtacatcttttgggctttgagt
tttgcctttcttgcagtttccttggtgaaagtatttgctccgtatgcctgtggctccgga
attccagagattaaaactattttgagtggattcatcatcagaggttacttgggaaagtgg
actttaatgattaaaaccatcacattagtgctggctgtggcatcaggtttgagtttagga
aaagaaggtcccttggtacatgttgcctgctgctgtggaaatatcttttcctacctcttt
ccaaagtatagcacaaatgaagctaaaaagagggaggtgctgtcagccgcctcagctgct
ggtgtctctgtggcttttggtgcgccaattggaggagtgctttttagtttggaggaggtt
agctattattttcctctcaaaactttatggagatcgttttttgctgctttggtggcggcc
tttgttttgagatccatcaatccatttggtaacagccgtctggtccttttttatgtggag
tatcatacaccatggtacctttttgaactgtttccttttattctcctaggggtatttgga
gggctttggggagctttttttattagggcaaatattgcctggtgtcgccgacgcaagtcc
accaaatttggaaagtatcctgttcttgaagtcattattgttgcagccattactgctgtg
atagccttccccaacccatacacaaggctcaacaccagtgaactgattaaagagctgttt
acagactgtggccccttggaatcctcctctctttgtgactacagaaatgacatgaatgcc
agtaaaattgttgatgatattcctgaccgaccagcaggcgttggagtatattcagctatc
tggcagttgtgcctagcactcatatttaaaataataatgacagtattcacttttggtatc
aaggtcccgtcgggcctgtttatccccagcatggcgatcggagccattgcagggaggatt
gtggggattgctgtggagcagctcgcctactaccaccacgactggttcatcttcaaggag
tggtgtgaggtcggggctgactgcatcactcctgggctgtatgccatggttggtgctgcc
gcatgcttaggtggtgtgacaagaatgactgtctctctggtggttattgtttttgaactt
actggaggcttggaatatattgttcctcttatggctgcagtaatgaccagtaaatgggtt
ggtgatgcctttggtagggaaggtatttatgaagcacacatccgactaaatgggtaccct
ttcttggatgcaaaagaagaattcactcatacaaccctggctgctgatgtcatgagacct
cgaagaagtgaccctcccttagctgttttgacacaggacaatatgacagtagatgacata
gaaaacatgattaatgagaccagctataatggctttcctgttataatgtcaaaagaatct
cagagattagtgggatttgccctcagaagagacctgacaattgcaatagaaagtgccaga
aaaaaacaagaaggtgttgttggcagttctcgggtgtgctttgcccaacacactccatct
cttccagcagaaagtcctcggccattaaaactgagaagcatccttgacatgagtcctttt
acagtgacagaccacaccccaatggagattgtggtagacatcttccgaaagcttggtctg
aggcagtgccttgtcactcacaatgggcgcctccttggcattataacaaaaaaagatatc
ctccgtcatatggcccagacggcaaaccaagaccccgcttcaataatgttcaactga

DBGET integrated database retrieval system