KEGG   Rattus norvegicus (rat): 84380
Entry
84380             CDS       T01003                                 

Gene name
Dhh
Definition
(RefSeq) desert hedgehog
  KO
K11990  desert hedgehog
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    84380 (Dhh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    84380 (Dhh)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C46: hedgehog family
   84380 (Dhh)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 84380
NCBI-ProteinID: NP_445819
RGD: 620711
Ensembl: ENSRNOG00000053675
UniProt: G3V7Y0
Position
7q36
AA seq 396 aa
MALPASLLPLCCLALLALSVQSCGPGRGPVGRRRYVRKQLVPLLYKQFVPSMPERTLGAS
GPAEGRVTRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPG
VRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRN
HIHVSVKADNSLAVRAGGCFPGNATVRLRSGERKGLRELHRGDWVLAADAAGRVVPTPVL
LFLDRDLQRRASFVAVETERPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSV
LAPGGDALRPARVARVAREEAVGVFAPLTAHGTLLVNDVLASCYAVLESHQWAHRAFAPL
RLLHALGALLPGGAVQPTGMHWYSRLLYRLAEELMG
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggctctgccagccagtctgttgcccctgtgctgcttggcactcctggcactatctgtc
cagagctgcgggccaggccgaggaccggttggccggcggcgttacgtgcgcaagcaactt
gtgcctctgctctacaagcagtttgtgcctagtatgcccgagcggacccttggcgcgagt
gggccagcggaggggagggtaacaagggggtcggagcgcttccgggacctcgtccccaac
tacaaccccgacataatcttcaaggatgaggagaacagcggcgctgaccgcctgatgaca
gagcgttgcaaagagcgggtgaatgctctagccatcgcggtgatgaacatgtggcccgga
gtacgcctacgcgtgactgaaggttgggacgaggatggccaccacgcacaggactcactg
cactacgaaggccgtgccctggacatcaccacgtctgaccgtgaccgtaataagtatggt
ttgttggcgcgcctagcagtggaagccggattcgactgggtctactacgagtcccgcaac
cacatccacgtgtcggtcaaagctgataactcattggcggtccgagccggaggctgcttt
ccgggaaatgccacggtgcgcttgcggagcggcgaacggaaggggctgagggaactccat
cgtggtgactgggtactggccgctgatgcagcgggccgagtggtacccacgccggtgctg
ctcttcctggaccgggacctgcagcgccgcgcctcgttcgtggctgtggagaccgagcgg
ccaccgcgcaaactgttgctcacaccctggcatctggtgttcgccgctcgggggccagcg
cctgctccaggtgactttgcaccggtgttcgcgcgccgcttacgcgctggggactcggta
ctggctcccggcggggacgcgctccggcctgcgcgcgtagcccgcgtggcgcgcgaggaa
gccgtgggcgtgttcgcaccgctcacggctcacgggacgctgctggtcaacgacgtcctc
gcctcctgctacgcggttctagagagtcaccagtgggcccaccgcgcctttgctcctttg
cgtttgctgcacgcgctcggggcgctgctccccgggggtgcagtccagccgactggcatg
cattggtactcgcgcctcctttaccgcttggcggaggagttaatgggttga

DBGET integrated database retrieval system