KEGG   Rattus norvegicus (rat): 84382Help
Entry
84382             CDS       T01003                                 

Gene name
Tcf4
Definition
(RefSeq) transcription factor 4
  KO
K15603  transcription factor 4/12
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    84382 (Tcf4)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Ubiquitous (class A) factors
    84382 (Tcf4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 84382
NCBI-ProteinID: NP_445821
RGD: 69271
Ensembl: ENSRNOG00000012405
UniProt: Q62655
Position
18q12.1
AA seq 585 aa AA seqDB search
MTSRDLGSHDNLSPPFANSRIQSKTERGSYSSYGRENVQGCHQSLLGGDMDMGNPGTLSP
TKPGSQYYPYSSNNARRRPLHSSTMEVQTKKVRKVPPGLPSSVYAPSASTADYNRDSPGY
SSSKPAASTFSSSFFMQDGHHSSDPWSSSSGMNQPGYGGMLGNSHIPQSSSYCSLHPHER
LSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPANGTDSIMANRGTGAAGSSQTGD
ALGKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTAVWSRNGGQASSSPNYEGPLHSL
QSRIEDRLERLDDAIHVLRNHAVGPSTAVPGGHGDMHGIIGPSHNGAMGSLGSGYGTGLL
SANRHSLMVGAHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQ
GQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITSNNDDEDLTPEQKAERE
KERRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVR
ERNLNPKAACLKRREEEKVSSEPPPLSLAGPHPGMGDTANHMGQM
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgactagcagggatcttgggtcacatgacaatctctctccaccttttgccaattccaga
atacaaagtaaaacagaaaggggttcatactcatcttatgggagagaaaacgtacagggt
tgccaccagagtctcctcggaggggacatggatatgggcaacccaggaaccctttcgccc
accaaacctggctcccagtactacccatattccagcaataacgcccgacggaggcctctt
cacagtagtaccatggaggtgcagacaaagaaagtcagaaaagttcctccaggcttgcca
tcttcagtctacgctccttcagccagcactgccgactacaacagggactcaccaggctat
tcttcctccaagccagcagccagcactttctccagctccttcttcatgcaagatggccat
cacagcagtgacccttggagctcctccagtggaatgaatcagcccggctatggagggatg
ctaggcaactctcatatcccacagtctagcagctactgtagcctgcatccacatgaacgt
ctgagctatccatcgcactcctcggcagacatcaactccagtcttcctccgatgtccacg
ttccatcgaagtggcacaaaccattacagcacctcttcctgcacacctcctgccaacgga
acagacagtataatggcaaacagaggaactggggcagcaggcagctcccagactggagac
gctctggggaaagccctggcttcgatctattctcctgatcacacgaacaacagcttctcc
tccaacccttcaactcctgttggctcccctccttcactctcagcaggcacagctgtttgg
tctcgaaacggaggacaggcctcgtcatctcccaattacgaaggacccttgcactccttg
cagagccgaattgaagaccgtttagaaagactggacgacgcaattcatgttctccggaac
cacgcggtgggcccatccacagctgtgcccggtggccatggggacatgcatgggatcatc
ggaccctctcacaatggagcaatgggcagtctgggctcaggatatggaactggccttctc
tcagccaacagacattcactcatggtcggggcccaccgtgaagatggcgtggcactgaga
ggcagccattctctcctgccaaaccaggttccggttccacagcttccggtccagtctgca
acttcccctgacttgaacccaccccaagacccttacagagggatgccaccaggcctccag
ggacagagtgtgtcttccggcagctctgagatcaagtccgacgacgagggcgatgagaac
ctacaggacacaaaatcttccgaggacaagaaactagacgacgacaagaaggatatcaaa
tcaattactagcaataacgatgatgaggacctgaccccggagcagaaggccgagcgtgag
aaggagcggaggatggccaataacgcccgtgagcgcctgagggtccgtgatatcaacgag
gctttcaaggagctgggccgcatggtacagctccacctgaagagcgacaagccccagacc
aagctcctgattctccaccaggcagtggctgtcatcctcagcctggagcagcaagtgcga
gaaaggaacctgaacccaaaagctgcctgtctgaaaagaagggaggaagagaaggtgtcc
tcagagcctcccccgctctccttggctggcccacaccctgggatgggagacacagcgaat
cacatgggtcagatgtga

DBGET integrated database retrieval system