KEGG   Rattus norvegicus (rat): 84387
Entry
84387             CDS       T01003                                 

Gene name
Pglyrp1, Pglyrp, Pgrp
Definition
(RefSeq) peptidoglycan recognition protein 1
  KO
K01446  peptidoglycan recognition protein
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Amidase_2
Other DBs
NCBI-GeneID: 84387
NCBI-ProteinID: NP_445825
RGD: 621429
Ensembl: ENSRNOG00000013395
UniProt: Q9JLN4
Position
1q21
AA seq 183 aa
MLFAWAPFPALLGLADSCCFVVPRSEWKALPSECSKGLKKPVRYVVISHTAGSFCSSPDS
CEQQARNVQLYQMKQLGWCDVAYNFLIGEDGHVYEGRGWTIKGDHTGPIWNPMSIGITFM
GDYSHRVPAKRALRAALNLLKCGVSEGFLRSNYEVKGHRDVQSTLSPGDQLYEIIQSWDH
YRE
NT seq 552 nt   +upstreamnt  +downstreamnt
atgttgtttgcctgggctcccttccctgccctcctgggcctggcagactcctgctgtttc
gtcgtgccccgcagtgagtggaaggccctgccatccgagtgctccaagggcctgaagaaa
ccagtccgctacgtggtgatctcacacacagccggcagcttctgcagcagcccagactcc
tgtgaacagcaggcccgcaatgtgcagctttaccaaatgaaacagctgggctggtgcgat
gtagcctacaacttcctcattggagaggatggtcatgtctacgaaggccgaggctggacc
atcaagggtgaccacacagggcccatctggaaccccatgtctatcggcatcaccttcatg
ggtgactactcacaccgggtacctgcaaagcgggctctccgtgctgccctaaatcttctg
aaatgtggggtgtctgagggcttcctgagatctaactatgaggtcaaaggacatcgagat
gtgcaaagcactctgtctccaggtgaccagctctacgagatcatccaaagctgggaccac
taccgagagtga

DBGET integrated database retrieval system